KEGG   Helicobacter pylori Gambia94/24: HPGAM_02220Help
Entry
HPGAM_02220       CDS       T01917                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
heg  Helicobacter pylori Gambia94/24
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:heg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPGAM_02220
Enzymes [BR:heg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HPGAM_02220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
436057..436548
Genome map
AA seq 163 aa AA seqDB search
MMREILTNRFFPSLFKKRLDFSNRVVLGLGSNLKNPLKILKNCFLYFKNHSRIGKIFSSP
IYINPPFGYTKQPNFYNATIILKTSLSLRHFFALVFYIERRFGRARKRDFKDAPRTLDID
IIAFNQVILRQNDLTLPHPKWSERDSVLVPLTLQQILFKREEW
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcgagagatccttactaaccgctttttcccaagcctttttaaaaaaaggcttgat
ttttctaacagagtggttttagggttgggatctaatcttaaaaaccctttaaaaatatta
aaaaattgttttttatactttaaaaatcatagtagaatcggaaaaattttttcttcgccg
atttatatcaatccgccttttggttacactaagcaacctaatttctacaacgctacgatt
atccttaaaacatctttaagtttgcgccatttttttgctctggttttttatatagaaagg
cgttttgggcgtgcaaggaagcgcgattttaaagacgctccaagaactttggatattgat
attatcgctttcaatcaagtcattttgaggcagaatgatttgactttacctcaccctaaa
tggagtgaaagagactcggtgttagtgcctttaactttgcaacaaatcctttttaaaaga
gaagagtggtga

DBGET integrated database retrieval system