KEGG   Helicobacter pylori Gambia94/24: HPGAM_03335Help
Entry
HPGAM_03335       CDS       T01917                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
heg  Helicobacter pylori Gambia94/24
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:heg00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:heg00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:heg00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:heg00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
674385..675206
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKR
SLEDYFDTSYEIEHQIQGTNKENALKSIRNIIEKCCFSYVRQKQMKGLGHAILTGEALIG
NESFAVILADDLCISHDHPSVLKQMTSLYQKYQCSIVAIEEVALEEVSKYGVIRGELLEE
GVYEIKDMVEKPSQEDAPSNLAVIGRYILTPDIFDILRETKPGKNNEIQITDALLTQAKR
KRIIAYQFKGKRYDCGSVEGYIEASNAYYKKRL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgcctttttcctgccgctggctatggcacgcgctttttgccgatcact
aaaaccatccctaaagaaatgctacccattgtggataagcctttgatccaatacgctgtg
gaagaagcgatggaagcgggctgtgaagtgatggcgatcgttacgggcaggaataaacgc
agtttagaagattattttgacacgagctatgaaatagagcatcaaatccaaggcactaac
aaagaaaacgccttaaaaagcattcgtaacattatagaaaaatgctgtttttcctatgtg
cgccaaaagcaaatgaaaggcttagggcatgcgattttaaccggggaagccctcataggc
aatgagtcttttgcggtgattttagccgatgacttgtgcataagccatgatcacccaagc
gtgttaaagcaaatgacttcgttgtatcaaaaataccaatgttccattgtagccattgaa
gaagtggcgttagaagaagtttcaaaatacggcgtgattaggggcgaattgttagaagag
ggggtgtatgagattaaagacatggtggaaaaaccaagccaagaagacgccccaagcaat
ctggccgtcattgggcgctacattttaactccggatatttttgatattttgcgtgagact
aaaccgggtaaaaacaatgaaatccaaatcacagacgccttactcactcaagccaaaaga
aaacggatcatcgcttaccaattcaaaggcaagcgatacgattgcgggagcgtggaaggc
tatattgaagcgagtaacgcctattataaaaaacgcttataa

DBGET integrated database retrieval system