KEGG   Helicobacter pylori Gambia94/24: HPGAM_03345Help
Entry
HPGAM_03345       CDS       T01917                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
heg  Helicobacter pylori Gambia94/24
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:heg00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:heg00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
675628..676896
Genome map
AA seq 422 aa AA seqDB search
MDFLEIVGQVPLKGGVEISGAKNSALPILAATLLSRQEVKIKSLPQVVDIKAMALLLQNL
GAELEWLNPHTLQLSAKSLHHTEATYDLVRKMRASILVLGPLLARFKECLVSLPGGCAIG
ARPVDLHLKAMQQLGAEIKIEQGYIHAKTPKGLKGNDILFDKISVTGTENALMAASLAKG
ITRIINAAKEPEIAQLCAFLQSGGVEIEGVGSSELKIRGVESDALNLKDIQIIPDRIEAG
TYLCVGAITNSQLKINRIIPNHIQAITDKLIEIGFSLDIQENSIEIYPAKKRQAFEITTK
EYPGFPTDMQAQFMALATQCLGTSIIEETLFENRFMHASELQRLGASISLKTNVATISGS
TELTGSDVMATDLRASSALVLAALVAKGVSRVHRIYHLDRGYERLEDKINALGAKVLRLK
EK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttggactttttagagattgtaggacaagtccctttaaaagggggggtagaaatttcaggg
gcgaaaaactccgcactccccattttagccgccacgcttttaagccgccaagaagtcaaa
atcaaatctctgccccaagtggtggatataaaggcgatggcgttattgttgcaaaattta
ggcgcagaattagaatggcttaacccccacacgctccaactcagcgctaaatccctgcac
cacaccgaagccacttacgatttggtgcgtaaaatgcgcgcttctattttggttttaggc
cctttattagcgcgctttaaggaatgcttagtgagtttgcccggtgggtgcgctatagga
gctaggcctgtggatttgcacctaaaagcgatgcaacaattaggggctgaaatcaaaatt
gagcaaggctatatccatgcaaaaacccctaaaggcttgaaagggaatgatattttattt
gataaaatcagcgttacaggcacagaaaacgccctcatggcagcaagtcttgctaaaggg
atcacgcgtatcattaacgccgctaaagagccagagatcgctcaattgtgcgcgttttta
caaagcggaggcgtagaaattgagggcgttggcagcagcgagctaaagattaggggggta
gaaagcgacgctttaaatttaaaagacattcaaatcataccggataggattgaagcaggc
acttatttgtgcgtgggggctatcactaacagccagcttaaaatcaatcgtatcatccct
aaccatattcaagcgatcaccgataagctcatagaaattggtttttcgctagacattcaa
gaaaattctatagaaatttacccggccaaaaaacgccaagcctttgaaatcaccacgaaa
gaatacccgggctttcccacagacatgcaagcgcaattcatggcgttagccacgcagtgt
ttggggactagtatcattgaagaaacgctttttgaaaaccgcttcatgcatgcaagcgaa
ttgcaacgattgggggctagtattagccttaaaacgaatgtggctaccattagcggatcc
acagagcttaccgggagcgatgtgatggcgacggatttaagggcttcttcggctctcgtt
ttagccgctttagtggctaagggggtgagtagggtgcataggatttaccacttggatagg
ggttatgagagattggaggataaaatcaacgctttaggggcaaaagtgttgcgtttaaaa
gaaaaataa

DBGET integrated database retrieval system