KEGG   Helicobacter pylori Gambia94/24: HPGAM_03600Help
Entry
HPGAM_03600       CDS       T01917                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
heg  Helicobacter pylori Gambia94/24
Pathway
heg00071  Fatty acid degradation
heg00072  Synthesis and degradation of ketone bodies
heg00280  Valine, leucine and isoleucine degradation
heg00310  Lysine degradation
heg00362  Benzoate degradation
heg00380  Tryptophan metabolism
heg00620  Pyruvate metabolism
heg00630  Glyoxylate and dicarboxylate metabolism
heg00640  Propanoate metabolism
heg00650  Butanoate metabolism
heg00900  Terpenoid backbone biosynthesis
heg01100  Metabolic pathways
heg01110  Biosynthesis of secondary metabolites
heg01120  Microbial metabolism in diverse environments
heg01130  Biosynthesis of antibiotics
heg01200  Carbon metabolism
heg01212  Fatty acid metabolism
heg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:heg00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPGAM_03600
   00630 Glyoxylate and dicarboxylate metabolism
    HPGAM_03600
   00640 Propanoate metabolism
    HPGAM_03600
   00650 Butanoate metabolism
    HPGAM_03600
  Lipid metabolism
   00071 Fatty acid degradation
    HPGAM_03600
   00072 Synthesis and degradation of ketone bodies
    HPGAM_03600
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPGAM_03600
   00310 Lysine degradation
    HPGAM_03600
   00380 Tryptophan metabolism
    HPGAM_03600
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPGAM_03600
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPGAM_03600
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HPGAM_03600
Enzymes [BR:heg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPGAM_03600
Exosome [BR:heg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPGAM_03600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADU81549
UniProt: E8QM06
Position
complement(733679..734854)
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKNVGARQMGVSVLKDALNASGLEPSDVDSVVLGNVLGAG
LGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDSIVLGRDEVVVCGGVENMSA
APYLSFDMREGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREDQDAFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRDTTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSAKKAQKLGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDINLFELNEAFAAQSIAVLKELELNPNIVNMNGGAIAIGHPIGASGARILVTL
LHEMKRSGHGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaagcgtagcgctgtagggagttttttaggctct
ctaaagaatgtgggcgctaggcaaatgggcgttagcgtgcttaaagacgctttgaacgcg
agcggacttgagcctagcgatgtggattctgtcgttttaggcaatgtcttaggcgctggt
ttgggtcaaaatatcgccagacagatccaactggacgccggtatccctaatgacagaaac
gcttttagcgtcaatatggtttgcggatcgtctatgaaagctattcagttagcgcatgat
agcattgtgcttgggcgcgatgaagtggtggtgtgcggtggcgtggaaaacatgagcgca
gcaccttatctgtcgtttgacatgcgagaggggaaaagaatggggaatgcgaacatgata
gattccatgatacatgacggattatgggacgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacataagccgagaagatcaagacgcattcgcactc
caatcgcaactcaaagcgagagccgccatcaatgcagggaaatttcaagaagaaatcacg
cctattgaaatagcgaataaaaaaggcgtggtggtttttaaagaagacgaataccctaga
gacacgacgctagaatcccttgcaaagctcaaacccgcctttaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggcgcgagcattatcattttatgcagcgct
aaaaaagcgcaaaaattggggttaaaaacaatggccactatcaaggggtttggcttgggt
ggttgcagtccggatattatgggcatatgcccaagcatcgctattaaaaacaatcttaaa
aatgtcaaaatgaatctcaacgacatcaatctttttgaactcaatgaagcctttgccgcg
caaagcatcgccgtgttaaaagaacttgaattaaaccccaatatcgtgaacatgaatgga
ggcgcgatagcgattggccaccctattggcgcgagtggcgctaggatattggttactttg
ttgcatgaaatgaaaaggagtgggcatggcgtgggttgcgcgtcattgtgcgtgggtggc
ggtcaagggctatcagtggtagttgaacaaaaataa

DBGET integrated database retrieval system