KEGG   Helicobacter pylori Gambia94/24: HPGAM_05710Help
Entry
HPGAM_05710       CDS       T01917                                 

Definition
pyruvate flavodoxin oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
heg  Helicobacter pylori Gambia94/24
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:heg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HPGAM_05710
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPGAM_05710
   00020 Citrate cycle (TCA cycle)
    HPGAM_05710
   00620 Pyruvate metabolism
    HPGAM_05710
   00640 Propanoate metabolism
    HPGAM_05710
   00650 Butanoate metabolism
    HPGAM_05710
  Energy metabolism
   00680 Methane metabolism
    HPGAM_05710
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPGAM_05710
Enzymes [BR:heg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPGAM_05710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1161811..1162371
Genome map
AA seq 186 aa AA seqDB search
MFQIRWHARAGQGAITGAKGLADVISKTGKEVQAFASYGSAKRGAAMMAYNRIDDEPILN
HERFMQPDYVLVIDPGLVFIENIFANEKEDTTYIITSYLNKEELFEKKPELKTRKVFLVD
CLKISMETLKRPIPNTPMLGALMKVSGMLEIGAFKEAFKKVLGKKLTQEVIDANMLAIQR
AYEEVQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaataagatggcatgcacgagctggtcagggcgctatcaccggcgctaagggg
ctggctgatgtgatttcaaaaacaggcaaagaagtgcaagcgttcgcttcctatggttca
gctaaaaggggggctgctatgatggcttataaccgcattgatgatgagcctattttaaac
catgaacgcttcatgcaaccggattatgtgctggtgattgaccctggtttggttttcatt
gaaaacattttcgctaatgaaaaagaagacacgacctatatcatcactagctaccttaac
aaagaagaattgtttgaaaaaaaacctgaattaaaaacccgtaaggtgtttttagtggat
tgtttaaaaatctctatggaaaccttaaaacgccctatccctaacacgcccatgttaggg
gcgttgatgaaggtgtctggcatgcttgaaatcggggcttttaaagaagcttttaaaaaa
gttttaggcaaaaaactcacgcaagaagtcattgacgctaacatgctcgctatccaaaga
gcttatgaagaagttcaataa

DBGET integrated database retrieval system