KEGG   Helicobacter pylori Gambia94/24: HPGAM_05725Help
Entry
HPGAM_05725       CDS       T01917                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
heg  Helicobacter pylori Gambia94/24
Pathway
heg00010  Glycolysis / Gluconeogenesis
heg00020  Citrate cycle (TCA cycle)
heg00620  Pyruvate metabolism
heg00640  Propanoate metabolism
heg00650  Butanoate metabolism
heg00680  Methane metabolism
heg01100  Metabolic pathways
heg01120  Microbial metabolism in diverse environments
heg01130  Biosynthesis of antibiotics
heg01200  Carbon metabolism
Module
heg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:heg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPGAM_05725
   00020 Citrate cycle (TCA cycle)
    HPGAM_05725
   00620 Pyruvate metabolism
    HPGAM_05725
   00640 Propanoate metabolism
    HPGAM_05725
   00650 Butanoate metabolism
    HPGAM_05725
  Energy metabolism
   00680 Methane metabolism
    HPGAM_05725
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPGAM_05725
Enzymes [BR:heg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPGAM_05725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C Myb_DNA-bind_4
Motif
Other DBs
NCBI-ProteinID: ADU81932
UniProt: E8QII5
Position
1164025..1164969
Genome map
AA seq 314 aa AA seqDB search
MVKEVKTLKGFSQSAEKFQGSHLLCPGCGHGIIVREVLNAVDGPIVLGNSTGCLEVCSAV
YPHTSWDVPWIHIGFENGSTAISGVEAMYKALVNKGRYQGQRPKFVAFGGDGASYDIGFQ
FISGCMERGHDMTYICLDNENYANTGGQRSGSTPLGASTSTTPAGSVSFGKKEKKKDIVN
IMASHGVPYVAQLSPNKWKDMNKKIKTALDTEGPCFINALSPCTTEWKFDSNKTIELADM
AVDSLMFPLFEVFNGRELKITYRPRNIIPVRDYLAAQKRFKHLFKKENEHIIEELQKDVN
ERWEYLQRREEAKV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaagtcaaaacactcaaaggttttagccaaagcgctgagaaatttcaaggc
tcgcacttgctttgcccgggttgtgggcatggcatcattgtgcgcgaagttttaaacgct
gtagatgggcctattgttttaggcaattctaccggttgtttagaagtatgctcggctgtg
tacccgcacacttcatgggatgtgccttggattcatatcggttttgaaaacggctctacc
gctatttcgggggtggaggcgatgtataaggctttagtgaataagggccgctatcaaggt
caaagaccgaaattcgtggcgtttggaggcgatggggctagttatgatattggttttcaa
ttcatcagcggttgcatggaaagagggcatgacatgacttacatttgcttggataatgaa
aactacgccaataccggcggtcaaagaagcggttctacgccattaggggctagcacttct
accacgccagcgggatcggttagctttggtaaaaaagaaaagaaaaaagacatcgtcaat
atcatggcaagccatggagtcccttatgtggcgcaactctcgcctaacaaatggaaagac
atgaataaaaagattaaaaccgcgctagacactgaagggccttgctttatcaacgctctt
agcccatgcacgactgaatggaaatttgattccaataagaccattgaattagcggatatg
gctgtggatagcttgatgttccccttgtttgaagtctttaatggcagggaattgaaaatc
acttaccgcccaagaaatatcattcctgtaagggattatttagcggctcaaaagcgcttc
aaacaccttttcaaaaaggaaaacgaacacatcattgaagaattgcaaaaagatgtgaat
gagcgttgggaatacttgcaacgcagagaagaagctaaagtataa

DBGET integrated database retrieval system