KEGG   Helicobacter pylori Gambia94/24: HPGAM_06360Help
Entry
HPGAM_06360       CDS       T01917                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
heg  Helicobacter pylori Gambia94/24
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:heg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPGAM_06360
Enzymes [BR:heg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     HPGAM_06360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1297171..1298313
Genome map
AA seq 380 aa AA seqDB search
MIVKRLNPDALKNALQKIGPEKIAQDRMHQKGVSFVFEIQHLPLSAALILKQEAISVGGD
FATPRDCILAKEPFYDGVLIASANQLERLIVKCHSQPFGLKHLAQELKSHLKAKKPNTPQ
IMAVLNLTPDSFYEKSRFDSKKALEEIYQWLEKGITLIDIGAASSRPQSEIIDPKVEQDR
LKEVLLEIKSQKLYQHAHFSIDTYHATTAQMALEHYFSILNDVSGFSSAEMLEVARDYKP
TCVLMHTQKTPKDMQENVFYHNLFDEMDRFFKEKLEVLEKYALQDVILDIGFGFAKLKEH
NLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVQNRLAGTLSLHLMALQNGASILRA
HDIDEHIDLIKVFKSLEEAD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaaaacgccttaaccctgatgcgctcaaaaacgctctgcaaaaaataggccca
gaaaagatcgcgcaagatcgcatgcaccaaaaaggcgttagctttgtttttgaaatccaa
cacctgcccttaagcgctgcattgattttaaagcaagaggccataagcgttgggggcgat
tttgccacgccaagagattgcattttggctaaagagcctttttatgatggggtgttgatt
gcgagcgctaaccaattagaacgccttattgtgaagtgccattcccaaccctttgggctt
aaacatttagcgcaagaattaaaaagccacctcaaagccaaaaagcctaacaccccacaa
atcatggcggttttaaacttgactccggatagtttctatgaaaagagccggtttgacagc
aaaaaagcacttgaagaaatctatcaatggctagaaaagggtatcacgctcattgatata
ggcgcagccagttcaaggccgcagagtgaaatcattgatccaaaagtagagcaagatcgc
ttgaaagaagttttattagaaatcaaatcccaaaaactctaccaacatgcccattttagc
atagacacctaccatgccacaacagcccaaatggctttggagcattatttttctatcctt
aatgacgtgagcggttttagtagcgctgaaatgctagaagtcgcaagagattacaagccc
acttgcgttttaatgcatactcaaaaaacccccaaagacatgcaagaaaatgttttttac
cacaatctgtttgatgaaatggatcgtttttttaaggaaaaactagaggttttagaaaaa
tacgcgcttcaagatgttattttagatattgggtttggattcgctaaattaaaagagcat
aatttagccttaatcaagcacttaagccattttcttaagttcaaaaaacccctattggta
ggagcgagccgtaaaaacacgattgggcttatcaccgggcgcgaagttcaaaaccggctc
gctggcactttgagtttgcatttaatggcgttgcaaaatggggcgagtattttaagagcg
catgatattgatgaacatatagatttaatcaaagtgtttaagagtttggaagaagcggat
tga

DBGET integrated database retrieval system