KEGG   Helicobacter pylori Gambia94/24: HPGAM_07690Help
Entry
HPGAM_07690       CDS       T01917                                 

Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
heg  Helicobacter pylori Gambia94/24
Brite
Enzymes [BR:heg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     HPGAM_07690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1547937..1548989
Genome map
AA seq 350 aa AA seqDB search
MKKSILLGVCLAFSCVYALSDMDLIKKAKESQLEPMPMGKALKEYQIKKTRDVGIGTKNS
EIMTSAQVELGKMLYFDPRISTSYLVSCNTCHNLGLGGVDLIPSAIGSQWKKNPHLLSSP
TVYNSVFNDVQFWDGRVTHLNEQAQGPIQSSFEMGADPKVVVEKINSIPGYVKLFRKAYG
SKVKIDFKLIADSIAMFEATLITPSRYDDFLRGNPKALSKAEKEGLDLFISKGCVACHNG
INLGGTMQPFGVVKPYKFANVGDFKGDKNGLVKVPTLRNITETMPYFHNGQFWDVKDAIK
EMGSIQLGIEISDAEAKKIETFFEALKGKKPKIIYPELPVMTDKTPKPSF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatccattttattgggcgtttgcttggctttttcttgcgtttatgctttaagc
gatatggatttgattaaaaaagcgaaggaaagccaattagaacccatgcctatgggcaaa
gcactcaaagaataccagatcaaaaaaaccagagatgtgggcattggcaccaaaaacagc
gaaatcatgacctccgctcaagtggaattaggcaaaatgctctattttgaccctaggatt
tccacttcctatcttgtgtcttgcaacacatgccataatctgggcttaggcggggtggat
ctaatcccaagcgccataggctctcaatggaagaaaaacccccaccttttaagttcccca
acggtgtataactccgtgtttaacgatgtgcagttttgggatggtagggttacgcattta
aacgaacaagcgcaaggacccatccaatcttcttttgaaatgggggctgatcctaaagtc
gtggtagaaaaaatcaattccataccaggctatgtcaagctctttagaaaagcttatggc
tctaaagtcaaaattgattttaaattgatcgccgatagtatcgctatgtttgaagccacg
cttattaccccaagccgctatgatgattttttaagaggcaatcctaaagcgctcagtaaa
gccgaaaaagaggggctggatttattcatttctaaaggctgtgtggcgtgtcataatggc
atcaatcttggggggacgatgcagccttttggggtggtcaaaccttataaattcgctaat
gtgggcgatttcaaaggcgataaaaacgggcttgtgaaagtgcctactttaaggaatatc
accgaaacgatgccttatttccataacgggcaattctgggatgttaaggatgcgattaaa
gaaatgggctctatccagttaggcattgaaatcagcgatgcagaagcgaaaaagattgaa
actttctttgaagccttaaaaggtaaaaaacctaagataatctacccagaactccctgtg
atgacggacaaaacccctaaaccctctttttga

DBGET integrated database retrieval system