KEGG   Helicobacter pylori Rif2: C730_02565Help
Entry
C730_02565        CDS       T02318                                 

Definition
phospholipase A1
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
hei  Helicobacter pylori Rif2
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hei00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    C730_02565
   00565 Ether lipid metabolism
    C730_02565
   00590 Arachidonic acid metabolism
    C730_02565
   00591 Linoleic acid metabolism
    C730_02565
   00592 alpha-Linolenic acid metabolism
    C730_02565
Enzymes [BR:hei01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     C730_02565
    3.1.1.32  phospholipase A1
     C730_02565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
525422..526498
Genome map
AA seq 358 aa AA seqDB search
MLDEKSILLFMIFVVCQLEGKKFSQDNFKVDYNYYLRKQDLHIIKTQNDLSNSWYLPPQK
APKEHSWVDFAKKYLNMMDYLGTYFLPFYHSFTPIFQWYHPNINPYQRNEFKFQISFRVP
VFRHILWTKGTLYLAYTQTDWFQIYNDPQSAPMRMMNFMPELIYVYPINFKPFGGKIGNF
SEIWIGWQHISNGVGGAQCYQPFNKEGNPENQFPGQPVIVKDYNGQKDVRWGGCRSVSAG
QRPVFRLVWEKGGLKIMVAYWPYVPYDQSNPNLIDYMGYGNAKIDYRRGRHHFELQLYDI
FTQYWRYDRWHGAFRLGYTYRINPFVGIYAQWFNGYGDGLYEYDVFSNRIGVGIRLNP
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatgaaaaaagcattttgctctttatgatttttgtagtttgtcagttagaaggc
aaaaaattttcacaagataattttaaggtggattataactactatttgcgcaaacaggat
ttgcacatcattaaaacgcaaaacgatttgtccaattcttggtatctccctccacaaaaa
gcccccaaagaacattcttgggtggattttgctaaaaaatatttaaacatgatggattat
ctaggcacttattttctgcctttttatcatagtttcacccccatttttcaatggtaccac
cccaatatcaacccgtatcaacgcaatgagtttaagttccaaattagttttagagtgcct
gtatttaggcatattctttggactaaaggcacgctgtatttagcttatacccaaactgac
tggtttcaaatttacaatgacccccaatccgctcccatgcgaatgatgaatttcatgcct
gaactcatttatgtttatcctatcaattttaaaccttttgggggtaaaatagggaatttt
tctgaaatttggataggttggcagcacatttctaatggcgtggggggcgcgcaatgttac
caaccttttaataaagaaggcaatcctgaaaaccagtttccaggacaacctgtaatcgtt
aaagattataatgggcaaaaagatgtgcgctggggggggtgtcgttcggtgagcgcgggg
caacgccctgtgtttcgtttggtgtgggaaaagggaggcctaaaaatcatggtcgcttat
tggccctatgtcccttatgatcaatccaatcctaatttgattgattacatggggtatggt
aacgctaaaattgattacaggagagggcgccaccattttgaattgcagctttatgatatt
ttcacgcaatactggcgttatgatcgctggcatggagctttccgcttaggctatacctat
cgcattaacccttttgtggggatttatgcgcagtggtttaacggctatggcgatggcttg
tatgaatacgatgttttttccaatcgtataggggtaggaatacgcttaaacccttaa

DBGET integrated database retrieval system