KEGG   Helicobacter pylori Rif2: C730_05730Help
Entry
C730_05730        CDS       T02318                                 

Definition
(GenBank) ferrodoxin oxidoreductase beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
hei  Helicobacter pylori Rif2
Pathway
hei00010  Glycolysis / Gluconeogenesis
hei00020  Citrate cycle (TCA cycle)
hei00620  Pyruvate metabolism
hei00640  Propanoate metabolism
hei00650  Butanoate metabolism
hei00680  Methane metabolism
hei01100  Metabolic pathways
hei01120  Microbial metabolism in diverse environments
hei01130  Biosynthesis of antibiotics
hei01200  Carbon metabolism
Module
hei_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hei00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C730_05730
   00020 Citrate cycle (TCA cycle)
    C730_05730
   00620 Pyruvate metabolism
    C730_05730
   00640 Propanoate metabolism
    C730_05730
   00650 Butanoate metabolism
    C730_05730
  Energy metabolism
   00680 Methane metabolism
    C730_05730
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    C730_05730
Enzymes [BR:hei01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     C730_05730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C Myb_DNA-bind_4
Motif
Other DBs
NCBI-ProteinID: AFV45509
Position
1172368..1173312
Genome map
AA seq 314 aa AA seqDB search
MVKEVKTLKGFSQSAEKFQGSHLLCPGCGHGIIVREVLNAVDGPIVLGNSTGCLEVCSAV
YPHTSWDVPWIHIGFENGSTAISGVEAMYKALTNKGRYQGQKPKFVAFGGDGASYDIGLQ
FISGCMERGHDMTYICLDNENYANTGGQRSGSTPLGASTSTTPAGSVSFGKKEKKKDIVN
IMASHGVPYVAQLSPNKWKDMNKKIKTALDTEGPCFINALSPCTTEWKFESNKTIELADM
AVDSLMFPLFEIFNGRELKITYRPRNIIPVRDYLGAQKRFKHLFKKENEHIIEELQKDVN
ERWEYLQRREEAKV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaagtcaaaacactcaaaggttttagccaaagcgctgagaaatttcaaggc
tcgcacttgctttgcccaggttgtgggcatggcattattgtgcgcgaagttttaaacgct
gtagatgggcctattgttttaggcaattctaccggttgtttagaggtatgctcggctgtg
tatccgcacacttcatgggatgtgccttggattcatattggttttgaaaatggctctacg
gcgatttcaggggtggaagcgatgtataaagcgcttacgaataagggccgttatcaaggt
caaaaaccaaaatttgtggcgtttgggggcgatggggccagttatgatattggtcttcaa
ttcatcagcggttgcatggaaagagggcatgacatgacttacatttgcctagataatgaa
aactacgccaataccggcggtcaaagaagcggctctacgccattaggggctagcacttct
accacgccagcgggatcagtgagctttggtaagaaagaaaagaaaaaagacatcgtcaat
atcatggcaagccatggagtcccttatgtggcgcagctctcgcctaacaaatggaaagac
atgaacaaaaagattaaaaccgcgctagacactgaagggccttgctttattaacgctctt
agcccatgcacgactgaatggaaatttgaatccaataaaaccattgaattagcggatatg
gctgtggatagcttgatgttccccttatttgaaatctttaatggcagggaattgaaaatc
acttaccgccctagaaatatcattcctgtaagggattatttaggggctcaaaaacgcttc
aaacaccttttcaaaaaagaaaacgaacacatcattgaagaattgcaaaaagatgtgaat
gagcgttgggaatacttgcaacgcagagaagaagctaaagtataa

DBGET integrated database retrieval system