KEGG   Helicobacter pylori Rif2: C730_06330Help
Entry
C730_06330        CDS       T02318                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hei  Helicobacter pylori Rif2
Pathway
hei00860  Porphyrin and chlorophyll metabolism
hei01100  Metabolic pathways
hei01110  Biosynthesis of secondary metabolites
hei01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hei00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C730_06330 (hemD)
Enzymes [BR:hei01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     C730_06330 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Peptidase_S41
Motif
Other DBs
NCBI-ProteinID: AFV45627
Structure
PDB: 

Jmol
Position
1300394..1301074
Genome map
AA seq 226 aa AA seqDB search
MREIVWVHSQRIAPYKTLILNEFCYYPLELDPTPFNALIFTSKNAVFSLLETLKNSPKLK
MLQNIPAYALSEPTAKTLQDHHFKVAFMGEKAHGKEFVQEIFPLLEKKSVLYLRAKEIVS
SLDTILLEHGIDFKQAVVYENKLKHLTLSEQNALKPKEKSILIFTAISHAKAFLHYFEFL
ENYTAISIGNTTALYLQEQGIPSYIAKKPSLEACLELALSLRIKEC
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgagggagattgtatgggtgcattctcaaagaatcgccccttataagactctcatctta
aatgaattttgctactatcccttagaattagatccaaccccttttaacgccttgattttc
acctctaaaaatgcggtattttccttgctagaaactctaaaaaacagccccaaactcaaa
atgttacaaaacattcctgcttacgctttgagcgaacccaccgcaaaaaccttacaagat
caccattttaaagtcgcctttatgggggaaaaagcccatggcaaagagtttgttcaagaa
atctttcctttattggaaaaaaaaagcgttttgtatctcagggcgaaagagattgtctct
tctttagacaccattcttttagagcatggcattgatttcaagcaagccgttgtctatgaa
aacaagctcaaacatttaaccttaagcgaacaaaacgccctaaaacccaaagaaaagagt
attcttatttttaccgctataagccacgcaaaagcctttttgcactattttgaattttta
gaaaattacaccgctataagcattggcaacacgaccgctctttatttacaagaacaaggc
attccaagctatattgccaaaaagccctccttggaagcgtgtttagaactggctttgagt
ttgagaattaaggaatgttaa

DBGET integrated database retrieval system