KEGG   Halomonas elongata: HELO_1183Help
Entry
HELO_1183         CDS       T01311                                 

Gene name
fbaB
Definition
fructose-bisphosphate aldolase, class I (EC:4.1.2.13)
Orthology
K11645  
fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
hel  Halomonas elongata
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HELO_1183 (fbaB)
   01230 Biosynthesis of amino acids
    HELO_1183 (fbaB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HELO_1183 (fbaB)
   00030 Pentose phosphate pathway
    HELO_1183 (fbaB)
   00051 Fructose and mannose metabolism
    HELO_1183 (fbaB)
  Energy metabolism
   00680 Methane metabolism
    HELO_1183 (fbaB)
Enzymes [BR:hel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     HELO_1183 (fbaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
213281..214333
Genome map
AA seq 350 aa AA seqDB search
MTDIPQLLGDEADSLLNHECRGVPAESLYKPGPDFIDRVMADSDRSPQVLRNLQSIYNHG
RLGGTGYVSILPVDQGIEHSAGASFAPNPLYFDPANIVELAIEGGCNCVASTLGGLASVA
RRYAHKIPMMVKLNHNETLTYPAVYDQTLFGQVEQAHAMGCAAVGATIYFGSPESRRQIT
EISEAFERAHQLGMVTVLWAYLRNPEFKKDGSDYHVASDLTGQAIHMAATIKADIVKQKL
AENNGGYRAVGFGHTHDKVYDELTSDHPIDLARYQVANCYMGRIGLINSGGGSKGHSDLG
EAVRTAVINKRAGGMGLISGRKAFQKPMAEGVELLNAIQDVYLDDRISIA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatatcccacagctactcggcgatgaggcggacagcctgctgaatcatgagtgc
cggggcgtgccggccgagtcgctctataagccgggtccggacttcatcgaccgcgtgatg
gcggatagtgatcgcagtccccaggtgctgcgcaacctgcagtccatctataaccacggc
cgcctgggcggcaccggctatgtcagcatcctgccggtcgaccagggcatcgagcactcg
gccggtgcctcgttcgcgcccaatccgctctatttcgatcccgccaacatcgtcgagctg
gccatcgaaggtggctgcaactgcgtggcttcgacactcggtggcctggcctcggtggcg
cgtcgctacgcccacaagattccgatgatggtgaagctcaaccacaacgagacgctgacc
tatccggcggtctacgaccagacgctgttcggtcaggtcgagcaggcgcatgccatgggc
tgcgcggcggtgggcgcgaccatctacttcggctcgcccgagagccgtcgccagatcacc
gagatcagcgaggccttcgaacgggcccaccaactgggcatggtcacggtgttgtgggcc
tacctgcgcaatcccgagttcaagaaggatggcagcgactatcatgtcgcctccgacctc
accggtcaggccatccatatggcggcgaccatcaaggccgacatcgtcaagcagaagctg
gcggagaacaacggcggctatcgggccgtcggcttcggccacacccacgacaaggtctat
gacgaactgacctcggaccatcccatcgacctggcgcgctatcaggtggccaactgctac
atggggcgcatcggcctgatcaactcggggggcggttccaagggccactccgacctcggc
gaggcggtgcgcaccgcggtgatcaacaagcgtgccggcggcatggggctgatctccggt
cgcaaggccttccagaagcccatggccgaaggcgtcgaactgctcaacgccatccaggat
gtgtatctggacgacaggatcagcatcgcctga

DBGET integrated database retrieval system