KEGG   Halomonas elongata: HELO_1183Help
Entry
HELO_1183         CDS       T01311                                 

Gene name
fbaB
Definition
fructose-bisphosphate aldolase, class I (EC:4.1.2.13)
Orthology
K11645  
fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
hel  Halomonas elongata
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HELO_1183 (fbaB)
   01230 Biosynthesis of amino acids
    HELO_1183 (fbaB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HELO_1183 (fbaB)
   00030 Pentose phosphate pathway
    HELO_1183 (fbaB)
   00051 Fructose and mannose metabolism
    HELO_1183 (fbaB)
  Energy metabolism
   00680 Methane metabolism
    HELO_1183 (fbaB)
Enzymes [BR:hel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     HELO_1183 (fbaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
213281..214333
Genome map
AA seq 350 aa AA seqDB search
MTDIPQLLGDEADSLLNHECRGVPAESLYKPGPDFIDRVMADSDRSPQVLRNLQSIYNHG
RLGGTGYVSILPVDQGIEHSAGASFAPNPLYFDPANIVELAIEGGCNCVASTLGGLASVA
RRYAHKIPMMVKLNHNETLTYPAVYDQTLFGQVEQAHAMGCAAVGATIYFGSPESRRQIT
EISEAFERAHQLGMVTVLWAYLRNPEFKKDGSDYHVASDLTGQAIHMAATIKADIVKQKL
AENNGGYRAVGFGHTHDKVYDELTSDHPIDLARYQVANCYMGRIGLINSGGGSKGHSDLG
EAVRTAVINKRAGGMGLISGRKAFQKPMAEGVELLNAIQDVYLDDRISIA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatatcccacagctactcggcgatgaggcggacagcctgctgaatcatgagtgc
cggggcgtgccggccgagtcgctctataagccgggtccggacttcatcgaccgcgtgatg
gcggatagtgatcgcagtccccaggtgctgcgcaacctgcagtccatctataaccacggc
cgcctgggcggcaccggctatgtcagcatcctgccggtcgaccagggcatcgagcactcg
gccggtgcctcgttcgcgcccaatccgctctatttcgatcccgccaacatcgtcgagctg
gccatcgaaggtggctgcaactgcgtggcttcgacactcggtggcctggcctcggtggcg
cgtcgctacgcccacaagattccgatgatggtgaagctcaaccacaacgagacgctgacc
tatccggcggtctacgaccagacgctgttcggtcaggtcgagcaggcgcatgccatgggc
tgcgcggcggtgggcgcgaccatctacttcggctcgcccgagagccgtcgccagatcacc
gagatcagcgaggccttcgaacgggcccaccaactgggcatggtcacggtgttgtgggcc
tacctgcgcaatcccgagttcaagaaggatggcagcgactatcatgtcgcctccgacctc
accggtcaggccatccatatggcggcgaccatcaaggccgacatcgtcaagcagaagctg
gcggagaacaacggcggctatcgggccgtcggcttcggccacacccacgacaaggtctat
gacgaactgacctcggaccatcccatcgacctggcgcgctatcaggtggccaactgctac
atggggcgcatcggcctgatcaactcggggggcggttccaagggccactccgacctcggc
gaggcggtgcgcaccgcggtgatcaacaagcgtgccggcggcatggggctgatctccggt
cgcaaggccttccagaagcccatggccgaaggcgtcgaactgctcaacgccatccaggat
gtgtatctggacgacaggatcagcatcgcctga

DBGET integrated database retrieval system