KEGG   Halomonas elongata: HELO_1183Help
Entry
HELO_1183         CDS       T01311                                 

Gene name
fbaB
Definition
fructose-bisphosphate aldolase, class I (EC:4.1.2.13)
Orthology
K11645  
fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
hel  Halomonas elongata
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:hel01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hel01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hel00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:hel00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hel00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:hel00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
213281..214333
Genome map
AA seq 350 aa AA seqDB search
MTDIPQLLGDEADSLLNHECRGVPAESLYKPGPDFIDRVMADSDRSPQVLRNLQSIYNHG
RLGGTGYVSILPVDQGIEHSAGASFAPNPLYFDPANIVELAIEGGCNCVASTLGGLASVA
RRYAHKIPMMVKLNHNETLTYPAVYDQTLFGQVEQAHAMGCAAVGATIYFGSPESRRQIT
EISEAFERAHQLGMVTVLWAYLRNPEFKKDGSDYHVASDLTGQAIHMAATIKADIVKQKL
AENNGGYRAVGFGHTHDKVYDELTSDHPIDLARYQVANCYMGRIGLINSGGGSKGHSDLG
EAVRTAVINKRAGGMGLISGRKAFQKPMAEGVELLNAIQDVYLDDRISIA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatatcccacagctactcggcgatgaggcggacagcctgctgaatcatgagtgc
cggggcgtgccggccgagtcgctctataagccgggtccggacttcatcgaccgcgtgatg
gcggatagtgatcgcagtccccaggtgctgcgcaacctgcagtccatctataaccacggc
cgcctgggcggcaccggctatgtcagcatcctgccggtcgaccagggcatcgagcactcg
gccggtgcctcgttcgcgcccaatccgctctatttcgatcccgccaacatcgtcgagctg
gccatcgaaggtggctgcaactgcgtggcttcgacactcggtggcctggcctcggtggcg
cgtcgctacgcccacaagattccgatgatggtgaagctcaaccacaacgagacgctgacc
tatccggcggtctacgaccagacgctgttcggtcaggtcgagcaggcgcatgccatgggc
tgcgcggcggtgggcgcgaccatctacttcggctcgcccgagagccgtcgccagatcacc
gagatcagcgaggccttcgaacgggcccaccaactgggcatggtcacggtgttgtgggcc
tacctgcgcaatcccgagttcaagaaggatggcagcgactatcatgtcgcctccgacctc
accggtcaggccatccatatggcggcgaccatcaaggccgacatcgtcaagcagaagctg
gcggagaacaacggcggctatcgggccgtcggcttcggccacacccacgacaaggtctat
gacgaactgacctcggaccatcccatcgacctggcgcgctatcaggtggccaactgctac
atggggcgcatcggcctgatcaactcggggggcggttccaagggccactccgacctcggc
gaggcggtgcgcaccgcggtgatcaacaagcgtgccggcggcatggggctgatctccggt
cgcaaggccttccagaagcccatggccgaaggcgtcgaactgctcaacgccatccaggat
gtgtatctggacgacaggatcagcatcgcctga

DBGET integrated database retrieval system