KEGG   Halomonas elongata: HELO_1298Help
Entry
HELO_1298         CDS       T01311                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
hel  Halomonas elongata
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hel00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(343356..344306)
Genome map
AA seq 316 aa AA seqDB search
MSDFNQPLGGNEMPRFGGPSTMMRLPTQSDAVGLDAAFIGIPMDIGTSNRPGTRLGPRQI
RDESRMLRPYNMATRAAPFDSLQVADIGDVPINTFNLPKNLDIITRHYDAVLAQDCVPLT
LGGDHTLTWPVLRAIAKKHGPVGLIHIDAHADINDQMFGEEVAHGCPFRRAQEEGLLDSQ
RVVQIGLRGTGYAADDFDWCREQGFRVVTAEECWYKSLAPLMAEVREQMGDGPVYISFDI
DGLDPSVAPGTGTVEMGGLTAQQGLEIVRGAQGLNVVGGDLVEVAPPYDTSGNTALMGAT
LLYEMLCVLPGVQYRD
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatttcaaccagcccctcggcggtaacgagatgccgcgcttcggcggcccctcc
accatgatgcgcctgcccacccagagcgacgccgtcggcctcgatgccgccttcattggc
atccccatggacatcggtacctcgaaccgcccgggcactcgtctggggccgcgccagatc
cgcgacgaatcgcgcatgctgcgcccctacaacatggccacccgcgccgcgcccttcgac
agcctgcaggtggccgacatcggcgacgtgccgatcaacaccttcaacctgcccaagaac
ctcgacatcatcacgcgccactatgacgccgtgctcgcccaggactgcgtgcccctgacc
ctgggcggcgaccacaccctgacctggcccgtgctgcgcgccatcgccaagaagcacggc
ccggtcgggctgattcatatcgatgcccatgccgacatcaacgaccagatgttcggcgaa
gaggtcgcccatggctgccccttccgccgcgcccaggaagagggcctgctggatagccag
cgcgtcgtccagatcggcctgcgcggcacgggctatgcggccgacgatttcgactggtgc
cgcgaacagggcttccgcgtcgtcaccgccgaagagtgctggtacaagtcgctggcgccc
ttgatggccgaggttcgcgagcagatgggcgacggcccggtctacatctccttcgacatc
gacggcctggatccctcggtggcgccgggtaccggcactgtggagatgggcggtctgacc
gcccaacaggggctggagatcgtgcgcggcgcccaggggctcaacgtggtcggcggcgat
ctcgtcgaagtcgccccgccgtacgacaccagcggcaataccgcactgatgggcgccacc
ctgctctacgagatgctgtgcgtactgcccggcgtccaataccgcgactga

DBGET integrated database retrieval system