KEGG   Halomonas elongata: HELO_1409Help
Entry
HELO_1409         CDS       T01311                                 

Gene name
bsaA
Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
hel  Halomonas elongata
Pathway
hel00480  Glutathione metabolism
hel00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    HELO_1409 (bsaA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    HELO_1409 (bsaA)
Enzymes [BR:hel01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     HELO_1409 (bsaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: CBV41292
UniProt: E1V6G3
Position
466904..467395
Genome map
AA seq 163 aa AA seqDB search
MSIHDHDCRTHGGEPFNLRALRGQVLLIVNVASRCGFTSQLGELERLYRRHRDRGFTILA
FPCNQFGRQSPESAAGFCSFGEQTYSVTFPLMEKVRVNGRHAHPLFVELKREAPGVLGTK
AIKWNFTKFLVARDGRVVRRFPPRAGIRELNEALESILDEPWG
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgagcatccatgaccacgattgccgcacccatggcggcgagcccttcaacctccgcgcc
ctgcgcggccaggtgctcctgatcgtcaatgtggccagccgctgtggcttcacgtcccag
ctcggcgaactcgagcgtctctatcggcgtcaccgcgaccgcggcttcaccatactggcg
ttcccctgcaatcagttcggacggcaatctcccgagtcggcggccggattctgctcgttt
ggtgaacagacctatagcgtgacctttccgctgatggaaaaggtgcgggtcaacgggcgc
cacgctcatcccttgttcgtcgagctcaagcgcgaggcgccgggagtcctggggacgaag
gccatcaagtggaatttcaccaagttcctggtggcccgggatggccgcgtcgtgcgtcgc
ttcccgccacgggcggggatcagggagctcaacgaggcgctggagtccattctggacgaa
ccctgggggtga

DBGET integrated database retrieval system