KEGG   Halomonas elongata: HELO_1501Help
Entry
HELO_1501         CDS       T01311                                 

Gene name
matA
Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
hel  Halomonas elongata
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    HELO_1501 (matA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HELO_1501 (matA)
Enzymes [BR:hel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     HELO_1501 (matA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(574573..575928)
Genome map
AA seq 451 aa AA seqDB search
MNMTFLQEMFNNITQRDALLRRRHGYNTNPDHADLVGACRALLESDGEASSIALASRALA
MYERLDGSERRRFFARLAEEFAADPTRIDQAYAAYSESRDNATLNGLFEACEPRRQELFR
RLNLASDGTYQLVRMREDLLALRREHPELAGIDADFAHLFASWFNRGFLMLKRIDWNTPA
SLLERIIHYEAVHEIHDWNDLRRRLDTRDRRCFAFFHPAIGDEPLIFVEVALCKGLPDHI
QPILAGEDSDVEAPEDADTAAFFGISNCQTGLRGISFGNFLIKQVVQELKQELPQLKHFV
TLSPVPGFAQWLKAQRDDDSTSEAQREALAALDEPGWHRDPERAEALKAVVRPMAARYLT
QEKNDRGLPLNPVARFHLGNGAELHRINWLGDISDKGLEQAAGLMVNYLYVLNDIERNHE
NYTANATVACSSEVRDLARKARKQQAKGELK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgaccttcctgcaggagatgttcaacaacatcacccagcgcgacgccttgctg
cgacgtcgccacgggtacaacaccaaccccgaccacgccgatctggtgggcgcctgccgc
gccctgctggagagcgatggcgaggcctcgagcatcgccctggccagccgcgccctggcc
atgtacgagcggctggatggcagcgaacgccggcgtttcttcgcccggctcgccgaggaa
ttcgccgccgatccgacgcgaatcgaccaggcctacgccgcctatagcgagtctcgcgac
aacgccaccctgaacggcctgttcgaggcctgcgaaccacggcgccaggagctgttccgg
cgactcaacctcgccagcgacggcacctatcaactggtccgcatgcgcgaggacctgctc
gccctgcgtcgcgaacacccagagctggcgggcatcgatgccgacttcgcccacctcttc
gcctcctggttcaatcgcggcttcctgatgctcaagcgcatcgactggaacacaccggcc
tcgctgctcgaacgcatcatccactacgaggcggtacacgaaatccacgactggaacgac
ctgcgccggcggctcgatacccgcgaccggcgctgtttcgccttcttccaccccgccatc
ggcgatgaaccgctgatcttcgtcgaagtggcgctgtgcaagggcttgccggatcacatc
cagccgatcctggcgggggaagacagcgacgtggaagcacccgaggatgccgacaccgcc
gccttcttcggcatcagcaactgccagaccgggctgcgcggcatttccttcggcaacttc
ctgatcaagcaggtggtgcaggaactcaagcaggaactgccccagctcaagcacttcgtc
accctttcgccggtgccgggcttcgctcaatggctgaaggcacagcgcgacgacgacagc
acgtccgaggcccagcgcgaggcgcttgcggccctcgatgagccgggctggcaccgggat
cccgaacgtgccgaggccctcaaggccgtcgtgcggccgatggccgcccgctatctgacg
caggagaagaacgaccggggattgccgctcaacccggtggcccgctttcacctcggcaac
ggcgccgagctgcatcgcatcaactggctcggcgacatctccgacaagggactcgagcag
gccgccggcctgatggtcaattacctctacgtgctcaacgacatcgaacgcaaccacgag
aactacaccgccaacgccaccgtggcctgctcgagtgaggttcgtgacctcgcccgcaag
gccaggaaacagcaggccaagggagagcttaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system