KEGG   Halomonas elongata: HELO_1532Help
Entry
HELO_1532         CDS       T01311                                 

Gene name
purK
Definition
phosphoribosylaminoimidazole carboxylase ATPase subunit (EC:4.1.1.21)
Orthology
K01589  
5-(carboxyamino)imidazole ribonucleotide synthase [EC:6.3.4.18]
Organism
hel  Halomonas elongata
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hel00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
612219..613331
Genome map
AA seq 370 aa AA seqDB search
MNIGVLGAGQLGRMLALAGYPLANRFTFLDTTGHPSAGIGDVMVDTDQKHLADFLAKVDL
VTYEFEHLPVPLVQAIEEHKPVHPSSEAIRICQNRAEEKALFDRLGIPTPAYRLVDSAEA
LEDAVRELGTPVVAKSVTEGYDGKGQAVIKTPSEAAEAWRSINHPRLIVEAFVDFVREVS
IIAVRGRDGQVVFYPMAENLHVDGILRYSLAPMPDLDAAIQDTADGYIRALLDELDYVGV
LTLELFQTPDGGLLANEMAPRVHNSGHWTMDGAVTSQFENHLRAIQGLPLGDTAARMPSC
MVNVIGQEGEAARLLEIEDAHLHRYDKGERPGRKLAHVNLLAPTHAELIEKVRRCAELLP
GAPTPRFSFE
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcggtgtactgggagccggccagctgggccggatgctggccctggcgggctac
ccgctggccaatcgcttcaccttcctcgataccaccggccatcccagcgccggcatcggc
gatgtcatggtggataccgaccagaagcatctggccgacttcctggccaaggtcgacctg
gtcacctatgagttcgagcacctgccggtgccgctggtccaggccatcgaggaacacaag
cccgttcacccctccagcgaggcgattcggatctgccagaaccgtgccgaggagaaggcg
ctgttcgatcgcctgggaatccccacgccggcctatcgcctggtggacagcgccgaagcg
ctggaagacgcggtacgcgagctgggaacgccggtggtcgccaagtcggtgaccgaaggc
tatgacggcaagggccaggcggtgatcaagacaccgtccgaggctgccgaggcctggcgg
tcgatcaatcatccccggctgatcgtcgaggccttcgtcgatttcgtgcgcgaggtgtcg
atcatcgccgtacgcgggcgcgacggtcaggtggtcttctacccgatggccgagaacctc
cacgtggacggcatcctgcgctactcgctggcgcccatgccggatctcgatgccgccatt
caggacaccgccgatggctatatccgggcgctgctcgacgagctcgattacgtcggcgtg
ctgaccctggaactcttccagacgcccgatggcgggctgctggccaacgagatggcgccc
cgggtgcacaactccggccactggaccatggatggcgcggtgaccagccagttcgagaac
catctgcgtgccattcagggcctgccgctcggcgataccgccgcccggatgccgtcgtgc
atggtcaatgtcatcggccaggaaggcgaagcggcgcgcttgctcgagattgaagacgcc
cacctgcaccgctacgacaagggcgaacgccccgggcgcaagctggcccacgtcaacctg
ctggcgccgacccatgccgagctgatcgagaaagttcgtcgttgcgccgaactgttgccc
ggcgcaccgacaccgcgcttcagcttcgagtga

DBGET integrated database retrieval system