KEGG   Halomonas elongata: HELO_1560Help
Entry
HELO_1560         CDS       T01311                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
hel  Halomonas elongata
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HELO_1560
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    HELO_1560
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HELO_1560
Enzymes [BR:hel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     HELO_1560
Exosome [BR:hel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HELO_1560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
645051..646634
Genome map
AA seq 527 aa AA seqDB search
MTFCMKQKTAVGPLVGGMLLASVAAPASAAEVKNVILMIGDGMGPQQVGLLETYANQAPD
SIYDGEPTAFHQLAKEGVVGFSLTHPEDAVVVDSACSATQLASGIYSGSEVIGIDAEGNP
VETVLELAQARGKATGLVSDTRLTHATPAAFAAHQPHRSLENEIAVDMLEVGPDVMLSGG
LRHWVPQLASEDAEVTSLMDGAYEPASKRQDDRNLLAEAVEKGYGLAFSREQLEADQSDK
LLGLFANSGMADGIEYRNTRDDADRLEPTLHEMTQAALNRLEQDEDGFFLMVEGGQIDWA
GHSNDAGTMLNEMVKFEEAVQGVYDWAKGREDTVILVTADHETGAFGLSYSSADLPEPQS
KSGPAFAERDYAPNFNFGDFALLDSLYQQKASFSTLLSEFGALEEEQRTPARLMEMVNAN
SDFQIDEEQAEAVLADKPNPYHVEGHSYLEAEEVPAIQDFDAFYPYNDRGNVLGRVLGTA
QNVVWGTGTHTHTPVNVFAWGPAETILPVSSIQHHSEVGQYLKSLVE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgacattttgcatgaagcaaaagacggcagtcggccctctggttggcgggatgttgctt
gcctcggtcgcggcgccggccagtgccgccgaggtcaagaacgtgatcctgatgatcggg
gacggcatggggccccagcaggtggggctattggaaacctatgccaaccaggctcccgat
tccatctacgatggcgagccgacggcgtttcaccaattggccaaggaaggcgtcgtcggt
ttttccctgacgcatcccgaggatgccgtcgtcgtggattccgcctgttccgccacgcag
ttggcgagtggcatctactccggtagcgaggtgatcggtatcgatgccgagggcaatccc
gtcgagacggtactcgagcttgcccaggcccggggcaaggcgaccggtctggtttcggac
actcgcctgacccatgccacgcccgcagccttcgccgcccaccagccccatcgttcgctg
gagaacgagatcgccgtggacatgctggaagtagggcccgacgtcatgctctcgggcgga
ctgcgccattgggtgccgcaattggcgagcgaggatgccgaggtcacgagcctgatggat
ggcgcttatgagccggcgtccaagcgtcaggacgatcgaaacctgctcgcggaagccgtc
gaaaagggctatggcctggcgttcagccgcgagcaactcgaggccgatcagagcgacaag
ctactgggcctgtttgccaactccggcatggccgatggtatcgagtatcgcaataccagg
gacgacgccgaccgcctcgagccgaccctgcacgagatgacgcaggccgcgctgaacagg
ctcgagcaggacgaggacggtttcttcctgatggtcgaaggcggtcagatcgactgggcg
gggcactcgaacgatgccggcaccatgctcaacgagatggtcaagttcgaggaggcggtt
caaggtgtctacgactgggccaaaggacgcgaggacaccgtgatcctggttaccgcggat
catgaaacgggcgcgttcgggctcagttattcatcggccgacctgccggagccgcagtcg
aagtcgggccctgccttcgcggaacgggactatgcgcccaacttcaacttcggcgacttc
gcgcttctcgattccctctatcagcagaaggccagcttttcgaccctgctgagtgagttc
ggggcactcgaagaagaacagagaacgccggctcgtctgatggaaatggtcaatgccaac
agcgatttccagatcgacgaagagcaggcggaagcggtcctggccgataagccgaacccc
taccacgtggagggtcacagctatctcgaagccgaggaggtcccggccatccaggacttt
gatgcgttctacccctataacgatcggggcaatgtactggggcgtgttctgggtactgca
cagaatgtcgtctggggcaccggtacccatacccacactccggtgaatgtcttcgcctgg
gggccggccgagaccattctgccggtatcctcgatccagcatcattccgaggtcggtcag
tacctcaagtcgctggtcgagtga

DBGET integrated database retrieval system