KEGG   Halomonas elongata: HELO_1758Help
Entry
HELO_1758         CDS       T01311                                 

Gene name
fadB
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:4.2.1.17)
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
hel  Halomonas elongata
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HELO_1758 (fadB)
   01212 Fatty acid metabolism
    HELO_1758 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    HELO_1758 (fadB)
   00650 Butanoate metabolism
    HELO_1758 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    HELO_1758 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    HELO_1758 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HELO_1758 (fadB)
   00310 Lysine degradation
    HELO_1758 (fadB)
   00380 Tryptophan metabolism
    HELO_1758 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HELO_1758 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    HELO_1758 (fadB)
   00281 Geraniol degradation
    HELO_1758 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    HELO_1758 (fadB)
Enzymes [BR:hel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     HELO_1758 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     HELO_1758 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     HELO_1758 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     HELO_1758 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
884606..886789
Genome map
AA seq 727 aa AA seqDB search
MIYQGNAISVARDDEGIATLTFDLKDESVNKLSSAVVQELEQALEALRGESDIAGLVLAS
AKDAFIVGADITEFHGLFAKGEDEIQSMLEQVHGIFNGLEDLPFPTVSAINGLALGGGCE
VTLATDFRVMSETAKIGLPETKLGILPGWGGCVRLPRLIGADNAIEWIAGGTENRADACL
SVGAVDAVVPPESLEAAARDILNRARSGELDYQARRTEKCSPLGLDAIEQMMAFETAKGY
VAGKAGPHYPAPIEAIKVIQKGAGEERARAQAIEAKAFGKLALTDVCYNLVGLFLNDQVV
KKKGGQYAKQSVPVERAGVLGAGIMGGGIAYQSASKGTPILMKDIKDEAIELGLKEARKL
FAKQVERGKLSNEQMAERLSNIRPTLSYGDFSHVDLVVEAVVENPKVKGAVLAEVEENVS
EDTILTSNTSTISITRLAENLKRPENFCGMHFFNPVHRMPLVEVIRGEKTGDGAVAATVA
YARKMGKTPIVVNDCPGFLVNRVLFPYFGGFSQLMAAGADFQRVDRVMEKFGWPMGPAYL
LDVVGMDTAVHAGEVMAEGFPERMGSLGGAGSEGKSAIQVMFDNERLGQKNAKGFYAYEE
DKKGKPRKVRDEAAIELVKGIAESGREFSDEDIIARMMTPLCLETVRCLEDGIVGTPAEA
DMALIYGIGFPPFRGGALRYIDAMGLEAFVAQADELAAELGALYAPTDRLREMARNGERF
YQDAAEA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgatctatcaaggcaatgccatctcggtggcgcgcgatgacgagggcatcgcgaccctg
accttcgacttgaaggatgagtcggtcaacaagctgtccagcgctgtggtccaggaactg
gaacaggcgctggaagcgctgcgtggcgaatccgacatcgcaggcctggtgctggccagt
gccaaggacgccttcatcgtcggcgccgacatcaccgagttccacggtttgttcgccaag
ggcgaggacgagattcagagcatgctcgagcaggtgcacgggatcttcaacggtctcgag
gacctgcctttccccacggtcagcgccatcaacggcctggctctggggggcggctgcgag
gtgacgttggccaccgattttcgcgtgatgagcgagaccgccaagatcggcctgcccgag
accaagctcggcatcctgcccggctggggtggctgcgtgcgtctgccgcggctgatcggc
gccgacaacgccatcgagtggatcgccggtggcaccgagaatcgcgccgatgcctgcctg
tcggtcggcgcggtcgacgccgtggtgccgcccgagtctctcgaggcagcggcgcgcgac
attctgaatcgggcccggagcggcgaactcgattaccaggcacgtcgcacggaaaaatgc
agccccctgggcctcgacgccatcgagcagatgatggccttcgagacggccaagggctat
gtggccggcaaggccggaccgcattacccggcgccgatcgaggcgatcaaggtcatccag
aagggagccggcgaggagcgcgcccgggcccaggccatcgaagccaaggcgttcggcaag
ctggcgctcaccgatgtctgctacaacctggtgggcctcttcctcaacgatcaggtggtc
aagaaaaagggcggtcagtacgcgaagcaatcggtgcccgtggagcgggccggggtgctc
ggcgcgggtatcatgggcggcggcatcgcctatcagagcgcctccaagggcacgccgatc
ctgatgaaggacatcaaggacgaggccatcgaactggggctcaaggaggcccgcaagctg
ttcgccaagcaggtggagcgcggcaagctctccaacgagcagatggccgagcggctcagc
aacatccggccgacgctttcctatggcgatttctcccacgtcgacctggtggtcgaggcg
gtggtcgagaatcccaaggtcaagggggcggtgctcgccgaggtcgaggagaacgtgagc
gaggacaccatcctcacctccaatacctcgaccatctcgatcacccggctcgccgagaac
ctgaagcggcccgagaatttctgcggcatgcacttcttcaacccggtgcatcgcatgccg
ctggtcgaggtcattcgcggtgaaaagaccggcgacggtgccgtggccgcgaccgtggcc
tatgcccgcaagatgggtaagacgcccatcgtggtcaatgactgcccgggctttctggtc
aaccgcgtgctcttcccctatttcggcggcttcagccaactgatggccgccggggccgac
ttccagcgcgtcgacagggtgatggagaagttcggttggccgatgggcccggcctatctg
ctcgacgtggtgggcatggataccgccgtgcacgccggtgaggtgatggccgaaggcttc
ccggagcgcatgggcagcctgggcggtgccgggagtgagggcaagagcgccatccaggtg
atgttcgacaatgagcgtctggggcagaagaacgccaagggcttctatgcctacgaagag
gacaagaagggcaagcccaggaaggtccgcgacgaggcggccatcgagctggtcaagggc
attgccgagtcgggccgcgagttttccgacgaggacatcatcgcgcggatgatgacgcct
ctgtgcctggagaccgtgcgttgcctggaggatggcatcgtcggcacgccggccgaggcc
gacatggcgctgatctatggcatcggcttcccgccgttccggggtggtgcgctgcgctat
atcgacgccatggggctggaggcgttcgttgcccaggccgacgagctggccgccgaactc
ggggctctctacgcgccgaccgacaggctgcgcgagatggcgcgcaacggcgagcgtttc
tatcaggatgccgccgaggcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system