KEGG   Halomonas elongata: HELO_1817Help
Entry
HELO_1817         CDS       T01311                                 

Gene name
cobD
Definition
threonine-phosphate decarboxylase (EC:4.1.1.81)
Orthology
K04720  
threonine-phosphate decarboxylase [EC:4.1.1.81]
Organism
hel  Halomonas elongata
Pathway
Porphyrin and chlorophyll metabolism
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HELO_1817 (cobD)
Enzymes [BR:hel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.81  threonine-phosphate decarboxylase
     HELO_1817 (cobD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
944970..946055
Genome map
AA seq 361 aa AA seqDB search
MKNAADNAWPAHGGRIAPLLARFGLPADHPVVDFSANLNPLGPPAWLSDWLAGAVDSLTR
YPDPDGTQARLAIARHEDVSLERVMVTHGGIEAIELAAAAHAGGRALIVAPTFGEYAMAC
RRHGLDVRTLISRGADFEPDIAELEAAMADAELLFLCRPNNPTGSLIARERVERLLARGR
ETRTTLVVDEAFVDFVDGDARLTPLLAEYDNLWLLRSMTKWFDVPGLRLGYLLAAPDTLD
RLRGWRAPWSVNALAEALVEPLLDDVDYLAATRRWLAGQRRVPEDVRALGFTVPQTHANF
FLLHGGAGTETMFEFLLRRGILARHTHNFPGLEGRWLRLALREEDDNARLLDALADWRGR
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacgcggcagataacgcctggccggcgcatggcggccgtatcgcgcccttgctg
gcacgcttcggattgccggccgatcatccggtggtggacttcagcgccaatcttaacccc
ctggggcctcccgcctggctcagcgactggctggccggggcggtcgacagcctcacgcgc
tatccggaccccgatggcacgcaggcccgcctggccatcgccaggcacgaggacgtgtcg
ctcgagcgggtcatggtgacccatggcggcatcgaggcgatcgaactcgctgccgccgcg
catgccggtgggcgtgcgctgatcgtggcgccgaccttcggcgagtacgccatggcgtgt
cggcggcacgggctggacgtacggacgctgatctcgcgcggcgcggatttcgagccggat
atcgccgagctggaggcggcgatggcggatgccgagctgctcttcctgtgtcgcccgaac
aatcccacggggagcctgatcgcccgcgagcgggtcgagcgcctgctggcgcgcggtcgc
gagactcgaacgacgctggtcgtggatgaagccttcgtcgacttcgttgatggcgatgcc
cggctgacgccgctgctggccgagtacgacaacctgtggttgctgcgctcgatgaccaag
tggttcgacgtgcctggcctgcgactcggctatctgctggccgcgcccgacacgctggat
cgactgcgcggatggcgagccccctggagcgtcaatgcgctggccgaggccctggtcgag
ccgctgcttgacgatgtcgactatctcgctgccacccggcgctggctggccggacagcgg
cgggttccggaggatgtgcgggcgctgggtttcacggtgccgcagacacatgccaacttc
ttcctgctgcatggcggggcgggcaccgagaccatgttcgagtttctgctgcggcgcggt
atcctggcgcgccacacgcacaacttcccgggactggaagggcgctggttgcgcctggcc
ctccgggaggaagacgacaatgcccggctgctcgacgccctggccgactggcgggggcgg
cgatga

DBGET integrated database retrieval system