KEGG   Halomonas elongata: HELO_1829Help
Entry
HELO_1829         CDS       T01311                                 

Gene name
bchI
Definition
magnesium chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
hel  Halomonas elongata
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HELO_1829 (bchI)
Enzymes [BR:hel01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     HELO_1829 (bchI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
956723..958462
Genome map
AA seq 579 aa AA seqDB search
MTDETAYPFVAVVGQQALKTALLLNVIDPRIGGVLISGPKGSAKSTLARALAAILPDDAE
GRRPPLVTLPLGASEERLTGSLDLQRVLAEGETRFQPGLLARAHGGLLYVDEVNLLPDSL
VDLLLDVAASGVNLVERDGISHSHPAEFGLIGTMNPDEGELRPQLLDRFGLCVEQQVAAD
VTERVAIVRQREAFDRDPRAFAAAHEAEQATLTRRLVEARERLSGISVEPWVYEHIATHS
QAAGVEGLRADVTWHRAARAHAAWRGEDRVGREDLDAVEPWVLAHRRTTEPETPPEQGGT
PPSGDGESGNAPGAGSTSHGQEADPAPQGQWGAMPPVTQPSVGAVLPSWPETTATAPRAG
ASSVPAASRQAGAQAGQGRTRRSRYDHLTPRPDWFATLVENRGRWPWQRLRYQHPRAGQP
MLHLVLLDTSASTLGQRLLGRAKGMVDGLVRQAYAAREQIAVLGFGNDGIATILPRRRSP
RDLLERLDATPGGGGTPLREAVQRAARLIRQWRCQDAGLKVRTYLITDGRTRQSLRGLPS
LGDCVVVDTEAAAVKRGRGRDIARRLGAAYRPLAGPEAT
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgaaaccgcgtaccccttcgtcgccgtcgtcggccaacaggcgctcaagacc
gcgctgttgctcaacgtcatcgatccccgcatcggcggcgtgctgatcagcggtcccaag
ggcagtgccaagtcgaccctggcccgagcgctggcggcgatcctgccggacgacgccgaa
ggccgtcgaccgccgctggtcaccttgccgctgggtgccagcgaggagcgcctgaccggc
agcctggatctgcaacgggtgctggccgagggcgagacgcgcttccagccgggattgctg
gccagggcccacggcggcctgctgtacgtcgacgaggtcaacctgctgccggattcgctg
gtggacctgctgctcgacgtggcggccagcggcgtcaatctcgtcgagcgtgacggtatc
agccattcccatccggcggagttcggcctgatcggcaccatgaatcccgacgagggcgag
ctgcggccccagttgctcgatcgcttcggcctctgcgtcgagcagcaggtggcggccgac
gtgacggagcgagtggccattgtgcgacagcgcgaagccttcgaccgcgacccccgagcc
ttcgccgcggcgcacgaggccgagcaggcgacgctgacacggcgtctggtcgaggctcgc
gagcggctgtccgggatctcggtcgaaccctgggtctacgagcacatcgccacgcacagc
caggccgccggagtagaggggctgcgggccgacgttacctggcaccgcgcggcccgggcc
cacgctgcctggcggggcgaggaccgggttggccgtgaggatctggacgccgtcgagccc
tgggtgctggcccatcgccgcaccaccgagcccgaaacgcctcccgagcagggcggtacg
ccgccgtccggcgatggagagagtggaaacgcgccgggtgccggctccacttcccatggc
caggaggccgacccggcccctcaggggcagtggggggccatgccgccggtgacgcagccg
agcgtcggcgcagtgctgccgtcgtggccggaaaccaccgccacggcgcccagggccggc
gcgtcctcggtaccggccgcgagccggcaggccggcgctcaggcgggccagggccgcact
cggcgctctcgatacgaccacctcacgccccgcccggactggttcgccaccctggtcgag
aaccgcgggcggtggccctggcagcgcctgcgctatcagcatccgcgcgccggccagccg
atgctgcacctcgttctgctggacacttccgcctccaccctcggccaacgcctgctgggc
cgggccaagggcatggtcgacggcctggtgcgccaggcctatgccgcccgcgagcagatc
gcggtgctggggttcggcaatgacggcatcgccaccattcttccccggcgtcgctcgccc
agggacctgctcgagcggctcgacgccacgcccggcggtggcggcacgccgctgcgcgag
gccgttcagcgggcggcgcggctgatccgccagtggcgatgtcaggatgccggtctcaag
gtgcgcacctacctgatcaccgacggccgtacccgccagtcgctacgcggcttgccgtcg
ctcggcgattgcgtcgtcgtcgacaccgaggccgccgccgtgaagcgggggcggggccgg
gatatcgcccgccggttgggcgcggcctaccggccgttggccggtccggaggcgacatga

DBGET integrated database retrieval system