KEGG   Halomonas elongata: HELO_2142Help
Entry
HELO_2142         CDS       T01311                                 

Definition
(GenBank) Acyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hel  Halomonas elongata
Pathway
hel00010  Glycolysis / Gluconeogenesis
hel00620  Pyruvate metabolism
hel00640  Propanoate metabolism
hel00680  Methane metabolism
hel01100  Metabolic pathways
hel01110  Biosynthesis of secondary metabolites
hel01120  Microbial metabolism in diverse environments
hel01130  Biosynthesis of antibiotics
hel01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HELO_2142
   00620 Pyruvate metabolism
    HELO_2142
   00640 Propanoate metabolism
    HELO_2142
  Energy metabolism
   00680 Methane metabolism
    HELO_2142
Enzymes [BR:hel01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HELO_2142
Lipid biosynthesis proteins [BR:hel01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HELO_2142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Gloverin
Motif
Other DBs
NCBI-ProteinID: CBV42026
UniProt: E1VAI0
Position
1305304..1306968
Genome map
AA seq 554 aa AA seqDB search
MTTTLPDYHAYLETFAIDDVVARLDDHRDGRLNAFEACCGRHLREGRAEVTALVHEDTRG
RITTLSYGELAAESEKLAGWLSERGLGEGDRIACMLPRSPQLLIAILASWRIGAVYQPLF
TAFGSDSVAYRLERADTRLVITDGDNRAKFDGLAQCPPVLAVGGPDAEHDDDLDWASALA
HSSIETAAPRQSPDAPFLQMFTSGTVGKPKGVAVPLAAMPAFALYMELAIGLDDSDRFWN
MADPGWAYGLYYAIAGPLLLGVTTHFCESGFSAEGALSFMERHGITNFAAAPTAYRLMKA
SGLFDDARERLSLRRASSAGEPLNTEVVTWVETALGCSVMDHYGQTETGMTCCNHHALAH
PKHVGGMGVPMPGYRLAILDAEYNELPPGEPGVLAVDIARSPAHFFPGYTWQEKEPFVGG
YYLTGDVVQRNEDGSFQFAGRDDDIITTAGYRVGPTDVENSVLMHPAVAESAAVGQPDEI
RGEIIKSYVVLRDGVEASDTLADEIRQQVRERLSTHAFPRVIEFVDTLPKTPSGKIQRFK
LRADAADKAETAAQ
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgacccttcccgactatcatgcctatctcgagacctttgccatcgacgatgtc
gtcgcccggctcgacgaccatcgcgatggccggttgaatgccttcgaggcgtgttgtggt
cgccacttgcgcgaagggcgcgccgaggtgacggccctggtccacgaggacactcgagga
cggatcacgacgttgagctatggcgaactggctgccgaaagcgagaagctcgccggctgg
ctctccgagcgtggcctgggcgagggcgaccgtatcgcctgcatgctgcctcgctcgcca
cagctgttgatcgcgatactggccagctggcgcatcggcgcggtctaccagccgctgttc
accgccttcggatccgattcggtggcgtatcggctggagcgtgccgatacccgcctggtg
atcaccgatggcgacaatcgcgccaagttcgatggtctggctcagtgtccgccggtactc
gccgtgggtgggcccgatgccgaacatgacgatgacctggattgggcctcggccctggcg
cattcgtccatcgagacagcggcaccgcggcagtcgccggatgcccccttcctgcagatg
ttcacctccggcaccgtgggcaagcccaagggagttgccgtgccgctcgccgccatgccg
gccttcgcgctctacatggaactggccatcggtctcgatgacagcgaccgtttctggaac
atggccgatcccggctgggcctatggcctttactacgccatcgccggcccgctgttgctg
ggtgtgaccacgcacttctgcgagtccggcttcagtgccgagggtgcgctgagcttcatg
gagcgtcatggcatcaccaatttcgccgccgcgcccactgcctaccgcttgatgaaggca
tcgggactgttcgacgacgcccgggagcggctctccttgcggcgtgccagttccgccggc
gagccgctcaataccgaggtggtcacctgggtggaaacggcgctgggctgttcggtgatg
gaccactatggccagaccgagaccggcatgacctgctgcaaccatcacgccctggcgcat
cccaagcatgtcggtggcatgggcgtgccgatgcccggctatcgtctggcgatcctcgat
gccgagtacaacgagctgccgcccggggaacccggcgtgctggcggtcgacatcgcccgt
tctccggcacatttcttccccggctatacctggcaggagaaggaacccttcgtcgggggc
tattatctgaccggtgacgtggtgcagcgcaatgaggatggcagcttccagttcgccggt
cgcgacgacgacatcatcaccaccgccggttatcgggtcgggcccaccgatgtggagaac
tcggtgctcatgcatccggccgtggcggagtcggccgcagtgggccagcccgacgagatt
cgcggcgagatcatcaagtcctatgtggtgctgcgagacggtgtcgaggccagcgataca
ctcgccgacgaaatccgccagcaagtgcgcgagcgcctctcgacccatgcctttcccagg
gtgatcgaattcgtcgacaccctgcccaagacacccagcggcaagatccaacgcttcaag
ctgcgcgcggatgccgccgacaaggcggagacggccgctcaatga

DBGET integrated database retrieval system