KEGG   Halomonas elongata: HELO_2142Help
Entry
HELO_2142         CDS       T01311                                 

Definition
acyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hel  Halomonas elongata
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HELO_2142
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HELO_2142
   00620 Pyruvate metabolism
    HELO_2142
   00640 Propanoate metabolism
    HELO_2142
  Energy metabolism
   00680 Methane metabolism
    HELO_2142
Enzymes [BR:hel01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HELO_2142
Lipid biosynthesis proteins [BR:hel01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HELO_2142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1305304..1306968
Genome map
AA seq 554 aa AA seqDB search
MTTTLPDYHAYLETFAIDDVVARLDDHRDGRLNAFEACCGRHLREGRAEVTALVHEDTRG
RITTLSYGELAAESEKLAGWLSERGLGEGDRIACMLPRSPQLLIAILASWRIGAVYQPLF
TAFGSDSVAYRLERADTRLVITDGDNRAKFDGLAQCPPVLAVGGPDAEHDDDLDWASALA
HSSIETAAPRQSPDAPFLQMFTSGTVGKPKGVAVPLAAMPAFALYMELAIGLDDSDRFWN
MADPGWAYGLYYAIAGPLLLGVTTHFCESGFSAEGALSFMERHGITNFAAAPTAYRLMKA
SGLFDDARERLSLRRASSAGEPLNTEVVTWVETALGCSVMDHYGQTETGMTCCNHHALAH
PKHVGGMGVPMPGYRLAILDAEYNELPPGEPGVLAVDIARSPAHFFPGYTWQEKEPFVGG
YYLTGDVVQRNEDGSFQFAGRDDDIITTAGYRVGPTDVENSVLMHPAVAESAAVGQPDEI
RGEIIKSYVVLRDGVEASDTLADEIRQQVRERLSTHAFPRVIEFVDTLPKTPSGKIQRFK
LRADAADKAETAAQ
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgacccttcccgactatcatgcctatctcgagacctttgccatcgacgatgtc
gtcgcccggctcgacgaccatcgcgatggccggttgaatgccttcgaggcgtgttgtggt
cgccacttgcgcgaagggcgcgccgaggtgacggccctggtccacgaggacactcgagga
cggatcacgacgttgagctatggcgaactggctgccgaaagcgagaagctcgccggctgg
ctctccgagcgtggcctgggcgagggcgaccgtatcgcctgcatgctgcctcgctcgcca
cagctgttgatcgcgatactggccagctggcgcatcggcgcggtctaccagccgctgttc
accgccttcggatccgattcggtggcgtatcggctggagcgtgccgatacccgcctggtg
atcaccgatggcgacaatcgcgccaagttcgatggtctggctcagtgtccgccggtactc
gccgtgggtgggcccgatgccgaacatgacgatgacctggattgggcctcggccctggcg
cattcgtccatcgagacagcggcaccgcggcagtcgccggatgcccccttcctgcagatg
ttcacctccggcaccgtgggcaagcccaagggagttgccgtgccgctcgccgccatgccg
gccttcgcgctctacatggaactggccatcggtctcgatgacagcgaccgtttctggaac
atggccgatcccggctgggcctatggcctttactacgccatcgccggcccgctgttgctg
ggtgtgaccacgcacttctgcgagtccggcttcagtgccgagggtgcgctgagcttcatg
gagcgtcatggcatcaccaatttcgccgccgcgcccactgcctaccgcttgatgaaggca
tcgggactgttcgacgacgcccgggagcggctctccttgcggcgtgccagttccgccggc
gagccgctcaataccgaggtggtcacctgggtggaaacggcgctgggctgttcggtgatg
gaccactatggccagaccgagaccggcatgacctgctgcaaccatcacgccctggcgcat
cccaagcatgtcggtggcatgggcgtgccgatgcccggctatcgtctggcgatcctcgat
gccgagtacaacgagctgccgcccggggaacccggcgtgctggcggtcgacatcgcccgt
tctccggcacatttcttccccggctatacctggcaggagaaggaacccttcgtcgggggc
tattatctgaccggtgacgtggtgcagcgcaatgaggatggcagcttccagttcgccggt
cgcgacgacgacatcatcaccaccgccggttatcgggtcgggcccaccgatgtggagaac
tcggtgctcatgcatccggccgtggcggagtcggccgcagtgggccagcccgacgagatt
cgcggcgagatcatcaagtcctatgtggtgctgcgagacggtgtcgaggccagcgataca
ctcgccgacgaaatccgccagcaagtgcgcgagcgcctctcgacccatgcctttcccagg
gtgatcgaattcgtcgacaccctgcccaagacacccagcggcaagatccaacgcttcaag
ctgcgcgcggatgccgccgacaaggcggagacggccgctcaatga

DBGET integrated database retrieval system