KEGG   Halomonas elongata: HELO_2173Help
Entry
HELO_2173         CDS       T01311                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
hel  Halomonas elongata
Pathway
hel00790  Folate biosynthesis
hel01100  Metabolic pathways
Module
hel_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HELO_2173 (folE)
Enzymes [BR:hel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     HELO_2173 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF OmpH DUF3638
Motif
Other DBs
NCBI-ProteinID: CBV42057
UniProt: E1VAL1
Position
1343413..1343970
Genome map
AA seq 185 aa AA seqDB search
MTEQLADHYRQIIQEIGEDPDREGLRDTPKRAAKAMQFLNRGYFQSLEEIVNGAVFESDT
DEMVLIKDIELYSICEHHLLPFTGKCHIAYMPSGKVLGLSKFARIVDMYARRMQIQENLT
RQIAEAVQQVTNARGVAVVIEARHLCMMMRGVEKQNSSMTSSVMLGAFRESQSTRQEFLT
LVQGR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacaactcgccgaccattaccgccagatcatccaagagatcggggaggatcct
gaccgggaaggcctgcgcgatacgcccaagcgtgccgccaaggccatgcaattcctgaat
cgtggttatttccagtccttggaggagatcgtcaacggtgccgtcttcgagtcggacacc
gatgagatggtgctgatcaaggacatcgagctgtattcaatctgcgaacatcacctgctg
ccgttcaccggcaagtgtcatatcgcctacatgccgagcggcaaggtgctgggcctttcc
aagttcgcgcgcatcgtcgacatgtacgcgcggcgcatgcagatccaggagaacctgact
cgccagattgccgaggcggtccagcaggtcaccaacgcgcgcggcgtggcggtggtgatc
gaggcgcgtcacctgtgcatgatgatgcgcggcgtcgagaagcagaattcgagcatgacc
tcctcggtgatgctgggtgccttccgggagtcgcagagtacgcggcaggaattcctgacg
ctggttcaaggtaggtag

DBGET integrated database retrieval system