KEGG   Halomonas elongata: HELO_2186Help
Entry
HELO_2186         CDS       T01311                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hel  Halomonas elongata
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HELO_2186 (pfkA)
   01230 Biosynthesis of amino acids
    HELO_2186 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HELO_2186 (pfkA)
   00030 Pentose phosphate pathway
    HELO_2186 (pfkA)
   00051 Fructose and mannose metabolism
    HELO_2186 (pfkA)
   00052 Galactose metabolism
    HELO_2186 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    HELO_2186 (pfkA)
Enzymes [BR:hel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HELO_2186 (pfkA)
Protein phosphatases and associated proteins [BR:hel01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HELO_2186 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1358125..1359384)
Genome map
AA seq 419 aa AA seqDB search
MAQHNAFYAQSGGVTAVINASACGVIEACRRHDDRIGKVYAGHNGIIGALTEDLIDVSQE
SDEAIAALRHTPAGAFGSCRYKLKDIETHRTQYERLIEVFRAHDIRYFFYNGGGDSADTC
LKVSQLSEKMGYPLTAIHVPKTVDNDLPITDNSPGFGSVAKYIATSTLEASLDIASMCAT
STKVFVLEVMGRHAGWIAAAGALAGQGEGDPPHLVIFPEIDFDRAAVMARVEESVKKCGY
CVIVVSEGARYEDGTFLADSGNTDAFGHRQLGGVAPTLAGMIKQDLGYKYHWAVADYLQR
AARHLASKTDVDQAYAVGEKAVELALDGQNAKMPAIKRISDEPYAWTVEAAPLADVANRE
KFMPRDFIREDGFGITEQCRRYLAPLIQGEDFPPFENGLPKVAKLAKHRVERKLPEFKL
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggctcagcacaacgccttttatgcccagtccggcggcgtcaccgccgtgatcaatgcc
agcgcctgcggcgtcatcgaagcctgccggcgccacgacgaccgcatcggcaaggtctat
gccggacacaacggcatcatcggtgccctgaccgaggacctgatcgacgtcagccaggag
agcgacgaagccatcgcggcgttgcgtcacacgccggccggcgccttcggctcctgccgc
tacaagctcaaggacatcgagacccaccgcacccagtacgagcgcttgatcgaggtcttc
cgcgcccacgacatccgctacttcttctacaacggcggcggcgacagcgccgacacctgc
ctgaaggtctcgcagctttccgagaagatgggctatccgctcaccgccatccacgttccc
aagacggtggacaacgacctgccgatcaccgataactcgccgggcttcggcagcgtggcc
aagtacatcgccacctcgaccctggaggcctccctggacatcgcctccatgtgcgccacc
tccaccaaggtcttcgtgctcgaagtgatgggccgccacgccggctggatcgccgccgcc
ggcgccctggccggccagggcgagggcgatcccccgcacctggtgatcttccccgagatc
gacttcgaccgcgccgcggtcatggcccgcgtcgaggagtcggtcaagaagtgcggttac
tgcgtgatcgtggtgtccgaaggagcccgctacgaggacggcaccttcctggcggattcc
ggcaataccgacgccttcggtcaccgccagctcggcggcgtggcaccgacactggccggc
atgatcaagcaggatctcggttacaagtaccactgggcggtggccgactacctgcaacgc
gccgcgcgccacctggcctccaagaccgacgtcgaccaggcctacgccgtcggcgaaaag
gccgtggaactggctcttgacggacagaacgccaagatgcccgccatcaagcgcatcagc
gacgagccctatgcctggaccgtcgaggccgcaccgctggccgacgtggccaaccgcgag
aagttcatgccccgggacttcatccgcgaggacggcttcggcatcaccgaacagtgccgg
cgctacctcgccccgctgattcagggcgaggacttcccgcccttcgagaacggcctgccg
aaagtcgccaagctcgccaagcatcgcgtcgaacgcaaactgcccgagttcaagctttaa

DBGET integrated database retrieval system