KEGG   Halomonas elongata: HELO_2239Help
Entry
HELO_2239         CDS       T01311                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hel  Halomonas elongata
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HELO_2239 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HELO_2239 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HELO_2239 (trpA)
Enzymes [BR:hel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HELO_2239 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1418325..1419128
Genome map
AA seq 267 aa AA seqDB search
MNRIDQRFADLKAQGRRALIPYITAGDPAPAYTVGFMHALVRAGADVIELGVPFSDPMAD
GPVIQKACERALRHDVRLEHLFEMVSEFRRDDPETPVVLMGYLNPVERLGFETFADRASE
SGVDGVLLVDMPPEEADLLGPVLESRGLASIFLVAPTTSRARAATICAHGEGYLYYVSLK
GVTGGAAADADDIAAHLAPLREMTDLPLCVGFGIRDGASAAAVGRVADGVIVGSALVSRI
AENADRPEAIPAALEAVLGEMRQALDA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtatcgatcaacgtttcgccgatctcaaggcacagggccgccgtgcgctgatt
ccctatattaccgccggcgatccggcaccggcgtacacggtgggcttcatgcacgccctg
gtgcgcgccggggccgatgtcatcgagctgggggtaccgttttccgacccgatggccgat
ggcccggtgatccagaaggcctgcgagcgcgccctgcgccatgacgtgcgcctggagcac
ctgttcgagatggtcagcgaatttcgccgtgacgaccccgaaacgccagtggtgctgatg
ggctatctcaatcccgtggagcggctcggtttcgagacattcgccgatcgggccagcgaa
tccggggtcgacggcgtgctgctcgtcgacatgccgccggaagaggcagacctgctgggt
cccgtgctcgagtcgcgagggctggcctcgatcttcctggtggcccctaccacttcccgc
gcccgggccgctacaatatgcgcccacggcgagggatatctctactatgtttcgctcaag
ggcgtgaccggtggtgctgccgccgatgccgacgacatcgcggcccatctggcgccgctt
cgcgagatgaccgacctgcccctgtgcgtgggcttcggcattcgcgacggggcctcggcg
gcagcggtcgggcgcgtggccgatggagtgatcgtcggcagtgctctggtcagccgtatc
gccgagaacgctgatcggcccgaggcgattcctgccgccctcgaggcggtgctgggcgaa
atgcgccaggctctggatgcctga

DBGET integrated database retrieval system