KEGG   Halomonas elongata: HELO_2386Help
Entry
HELO_2386         CDS       T01311                                 

Gene name
cysQ
Definition
adenosine-3'(2'),5'-biphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
hel  Halomonas elongata
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    HELO_2386 (cysQ)
Enzymes [BR:hel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     HELO_2386 (cysQ)
Transfer RNA biogenesis [BR:hel03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    HELO_2386 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1581349..1582152
Genome map
AA seq 267 aa AA seqDB search
MRDRLLAGVEAAGREVLEIYNRTFHVETKEDDSPLTEADMASHHALVALLESVTPDVPVL
SEESGEIPYETRRTWERYWLIDPLDGTKEFIKKNGEFTLNVALVENGDPVFGIVHAPVLE
TTWYGQVGQGAWKVEQGTSSRIGVRALPREGGDTWKVVGSRSHGAEMFEAFCARLPQHER
VSMGSSLKLCLVAEGQADLYPRLAPTSEWDTAAAQAVVVAAGGEVLDAETLEPLRCNQQD
SVLNPFFIVCGERDQRWTNALKASLKA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgatcgcttgcttgccggtgtcgaggcggcggggcgcgaggtgctggagatctac
aaccgtacctttcatgtggaaaccaaggaggatgacagtcctctgaccgaagcggacatg
gcgtcccaccatgcgctggtggccttgcttgaatcggtgacgcccgatgtgccggtgttg
tccgaggagtccggcgagatcccctatgaaacgcgccgcacctgggaacgttactggttg
atcgatccgctggatggtaccaaggagttcatcaagaagaacggtgaattcacgctcaac
gtggctctggtcgagaatggcgacccggtattcggcatcgttcacgcgccggtactcgaa
accacctggtatggacaggttggtcagggcgcctggaaagtggagcagggaacgtcgagc
cgcatcggggtgcgtgccttgccacgcgagggtggtgacacctggaaggtagtgggcagt
cgctcccatggtgcagagatgttcgaagccttttgtgctcggctaccgcagcacgagcgg
gtctccatgggcagctcgctcaagctgtgcctggtggctgaaggtcaggcggatctctat
ccccggttggcacccaccagcgagtgggatactgctgccgctcaggcggtcgtcgtggcc
gctggcggcgaggtgctcgatgccgagacccttgagcccctgcgttgcaaccagcaagat
tccgtactcaacccattcttcatcgtttgcggtgagcgcgatcaacgctggaccaatgca
ctgaaagcgagcctgaaggcataa

DBGET integrated database retrieval system