KEGG   Halomonas elongata: HELO_2572Help
Entry
HELO_2572         CDS       T01311                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hel  Halomonas elongata
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HELO_2572 (galU)
   00052 Galactose metabolism
    HELO_2572 (galU)
   00500 Starch and sucrose metabolism
    HELO_2572 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HELO_2572 (galU)
Enzymes [BR:hel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HELO_2572 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1819098..1819991
Genome map
AA seq 297 aa AA seqDB search
MIRKAVLPVAGFGTRCLPASKAIPKEMITIVDRPVIQYVVQEAVDAGIRDIVLVTHGSKS
AIENHFDKHFELEASLEAKGKWELLEELRAIVPSDVNIISVRQSEPLGLGHAVLCARPVI
GDDEPFAVLLPDVLVDDSDLNGNNDLAGMVASFESRGRSQLMVEEVPHDMVHKYGIVAPE
GEAPAAGEACSLAGVVEKPTQDEAPSDLAVIGRYVLPGRIFPLLAETPPGAGDEIQLTDA
IETLRREEGVDAWRMRGRTYDCGHQLGYLEAILAYGRRHPSYGEGFRDLLTRYTGEE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcaaggctgttctacccgttgccggttttggcacccgctgcctgcccgcctcc
aaggcgattcccaaggaaatgatcaccatcgtcgatcgcccagtgatccagtacgtggtc
caggaagcagtggacgcgggtattcgcgacatcgtgctggtaacgcatggcagcaagagt
gccatcgagaaccacttcgacaagcacttcgaactcgaggcgagcctcgaggccaagggc
aaatgggagctgctggaagagctgcgtgccatcgtgccttccgatgtcaacatcatcagc
gtacgccagtccgaaccgctgggactcggccatgcggtgctctgtgcccgtccggtgatc
ggcgacgatgagccctttgccgtgctgctgccggatgttctggtcgatgacagcgatttg
aacggcaacaatgatctggccgggatggtggcatccttcgagagtcgtggtcgtagccag
ctgatggtcgaggaagtaccccacgacatggtgcacaagtatggcatcgtggcgcccgag
ggcgaagcaccggcggccggagaggcctgttctctggccggagttgtcgagaagccgaca
caggacgaagcaccttcagatctggccgtgatcggtcgttatgtcctgccggggcggatc
tttccgctgctggccgagacgccgcccggcgccggcgacgagatccagcttaccgatgcc
atcgagacgctgcgccgcgaggagggagtggatgcctggcggatgcgcgggcgtacctat
gactgcggccaccagctcggctacctggaggccatcctggcctacgggcgtcgtcatccc
agttacggtgaaggcttccgtgacctgctcactcgttacactggcgaggagtaa

DBGET integrated database retrieval system