KEGG   Halomonas elongata: HELO_2818Help
Entry
HELO_2818         CDS       T01311                                 

Gene name
adh2
Definition
zinc-containing alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
hel  Halomonas elongata
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    HELO_2818 (adh2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HELO_2818 (adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    HELO_2818 (adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    HELO_2818 (adh2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HELO_2818 (adh2)
   00626 Naphthalene degradation
    HELO_2818 (adh2)
Enzymes [BR:hel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HELO_2818 (adh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2112995..2114023
Genome map
AA seq 342 aa AA seqDB search
MDSTMKSAVVRTFREPLVIEEVPVPRPGPGEILVKVAASGVCHTDLHAARGDWPVKPEPP
FIPGHEGVGHVVAVGRGVQHVKEGDRVGVPWLYSTCGHCEHCLGGWETLCESQQNTGYSV
NGGFAEYTLAQADYVGKLPDNVGFVEIAPVLCAGVTVYKGLKMTDTRPGQWVVISGIGGL
GHMAVQYARAMGLNVAAVDVDDAKLALAERLGATITVNAMQTDPARYLKQTIGGAHGALV
TAVSPKAFEQALGMIRRGGTVALNGLPPGDFPLPIFDMVLNGITVRGSIVGTRLDLQEAL
DFAGEGKVQATVKTEKLENINTVFDQMTQGHIEGRIVLDLAG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtggacagcacaatgaaatccgccgtcgttcggaccttccgcgaaccgctggtcatcgag
gaagtcccggtaccgcgtcccggccctggcgagattctggtcaaagtcgccgcttcaggc
gtctgccataccgatcttcacgcagcccgtggcgattggccggtgaagccggaaccgcct
ttcattcccggccacgaaggtgtcggtcacgtggtcgccgtaggtagaggggtccagcac
gtcaaggaaggagatcgggtcggggtaccctggctatactctacctgcgggcactgcgag
cactgcctcggtggttgggagacgttgtgcgaatctcagcagaatactggatattcggtc
aacggtggctttgccgaatataccctggcccaagcagactacgtcgggaagctgcccgac
aacgtcggcttcgtcgagatcgccccagtgctgtgtgctggagtcaccgtctataaaggc
ctgaaaatgaccgacacccgaccggggcaatgggtggtgatttccggtatcggtggcttg
ggccacatggcagtgcagtacgcccgggctatgggattgaatgtcgccgcagttgacgtc
gacgatgccaagctcgcactcgccgagcggctgggggcaacgatcaccgtcaacgccatg
caaaccgaccccgcccgttacctcaagcagacgatcggcggcgctcatggggcactcgtc
actgcggtatcgcccaaagccttcgagcaggcgctgggcatgatccgtcgtggcggcacc
gtggctctcaacggcctgccgccgggcgatttccccctgccgatctttgacatggtgctc
aatggtatcactgtgcgtggttcgatcgtcggtacccggctcgatctccaggaggcgctg
gacttcgccggtgaagggaaggtccaggccacggtgaaaaccgaaaaacttgaaaatatc
aatacggtgttcgaccaaatgactcagggacacatcgagggacgcatcgttctcgacctg
gcaggctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system