KEGG   Halomonas elongata: HELO_2822Help
Entry
HELO_2822         CDS       T01311                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hel  Halomonas elongata
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hel00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2116520..2117299
Genome map
AA seq 259 aa AA seqDB search
MTTMQTPKDELVRNAEKQMRTGLSDNTWTDTQKLALTCRILFDGGHDSGLAGQITARGPQ
PGTYYTQRLGLGFDEISANNLLLVDEDLNVLEGNGIPNPANRFHSWVYRARNDVNCIIHT
HPLHIAALSMLEVPLAVSHMDICPLFEDCAFLESWPGVPVGNEEGEIISEALGDKRAILL
AHHGQLSTGQSIEEACVIAMLIERAAKLQLLAMSAGEIRSIPPELGREAHDWISKPKRHG
AAFNYYARRALRQHSDCLS
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccatgcagacacccaaagatgaactggtccgcaacgctgaaaagcaaatgagg
accggcctcagtgataatacctggaccgacacccaaaaactggccttgacctgccggatc
ctcttcgacggtgggcacgactcgggactcgccggccagatcacggctcgcggcccccag
cctggaacctattacacccaacgtcttggattggggttcgacgagatcagcgccaacaac
ctgttgctggtagacgaagacctcaatgtccttgaaggaaacggcattccgaatccagcg
aatcgcttccatagctgggtttatcgagctcgtaacgatgtgaactgcatcatccatacg
catccattgcatattgcagccctatcgatgctcgaagtgccgctggctgtgtcacacatg
gatatatgcccactctttgaagactgcgcctttctcgagagttggccaggcgtgccagtg
ggcaacgaggaaggcgagatcatctctgaggccttgggcgataagcgcgccatcctgctg
gcccaccacggacagctgtccaccgggcagtcgatcgaggaggcctgcgttatcgccatg
ttgattgaacgcgccgccaagctacagctcttggcgatgtcggctggcgagatccgctcc
atcccgccagagctgggccgcgaagcccacgactggatttcaaagcccaaacgccatggc
gccgctttcaactattacgcacgccgagccttgcgtcagcacagtgattgtttgagttga

DBGET integrated database retrieval system