KEGG   Halomonas elongata: HELO_2822Help
Entry
HELO_2822         CDS       T01311                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hel  Halomonas elongata
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HELO_2822
Enzymes [BR:hel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HELO_2822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2116520..2117299
Genome map
AA seq 259 aa AA seqDB search
MTTMQTPKDELVRNAEKQMRTGLSDNTWTDTQKLALTCRILFDGGHDSGLAGQITARGPQ
PGTYYTQRLGLGFDEISANNLLLVDEDLNVLEGNGIPNPANRFHSWVYRARNDVNCIIHT
HPLHIAALSMLEVPLAVSHMDICPLFEDCAFLESWPGVPVGNEEGEIISEALGDKRAILL
AHHGQLSTGQSIEEACVIAMLIERAAKLQLLAMSAGEIRSIPPELGREAHDWISKPKRHG
AAFNYYARRALRQHSDCLS
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccatgcagacacccaaagatgaactggtccgcaacgctgaaaagcaaatgagg
accggcctcagtgataatacctggaccgacacccaaaaactggccttgacctgccggatc
ctcttcgacggtgggcacgactcgggactcgccggccagatcacggctcgcggcccccag
cctggaacctattacacccaacgtcttggattggggttcgacgagatcagcgccaacaac
ctgttgctggtagacgaagacctcaatgtccttgaaggaaacggcattccgaatccagcg
aatcgcttccatagctgggtttatcgagctcgtaacgatgtgaactgcatcatccatacg
catccattgcatattgcagccctatcgatgctcgaagtgccgctggctgtgtcacacatg
gatatatgcccactctttgaagactgcgcctttctcgagagttggccaggcgtgccagtg
ggcaacgaggaaggcgagatcatctctgaggccttgggcgataagcgcgccatcctgctg
gcccaccacggacagctgtccaccgggcagtcgatcgaggaggcctgcgttatcgccatg
ttgattgaacgcgccgccaagctacagctcttggcgatgtcggctggcgagatccgctcc
atcccgccagagctgggccgcgaagcccacgactggatttcaaagcccaaacgccatggc
gccgctttcaactattacgcacgccgagccttgcgtcagcacagtgattgtttgagttga

DBGET integrated database retrieval system