KEGG   Halomonas elongata: HELO_3115Help
Entry
HELO_3115         CDS       T01311                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, D subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
hel  Halomonas elongata
Pathway
hel00020  Citrate cycle (TCA cycle)
hel00190  Oxidative phosphorylation
hel00650  Butanoate metabolism
hel01100  Metabolic pathways
hel01110  Biosynthesis of secondary metabolites
hel01120  Microbial metabolism in diverse environments
hel01130  Biosynthesis of antibiotics
hel01200  Carbon metabolism
Module
hel_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hel_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hel_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HELO_3115 (sdhD)
   00650 Butanoate metabolism
    HELO_3115 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    HELO_3115 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: CBV42999
UniProt: E1V4R1
Position
complement(2490239..2490586)
Genome map
AA seq 115 aa AA seqDB search
MVTNITNLGRSGLSDWLVQRASAIVLALYTLFIVGYLLFSPGLDYATWSGLFAQTWMRIF
SLLAFVSLSAHAWVGLWTVTTDYIKPTGIRVAAQSIIILAIFVFLVWGIQVLWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaacatcacgaatctcgggcgcagcgggctttccgactggctcgtgcagcgc
gcttcggccatcgtcctggccctctacacactctttatcgtcggctacctgctgttttcc
ccggggctggattacgccacctggagcggtctgttcgcccagacctggatgcggatcttc
tcgctgctggctttcgtgtcgctgtcggctcatgcctgggtcggcctgtggaccgtgacc
accgactacatcaagccgaccggcatccgtgtcgccgcccagtccatcatcatcctggcc
atcttcgtgttcctggtctggggcatccaagttctgtggggagcctga

DBGET integrated database retrieval system