KEGG   Halomonas elongata: HELO_3160Help
Entry
HELO_3160         CDS       T01311                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
hel  Halomonas elongata
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hel00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2539576..2540901
Genome map
AA seq 441 aa AA seqDB search
MLPQEAIRAKRDGQALDAAAIGELVAGIADGSLGDAQIGALAMAIFLNGMNATETVALTE
AVRDSGDVLDWTALDLPGPVIDKHSTGGVGDVVSLILGPWVAACGGHVPMISGRGLGHTG
GTLDKLESIPGYSVTPDTATFRRLVEDVGVAIIGQTADLAPADKRLYAIRDVTATVESLP
LIVSSILGKKLACGLDALVMDVKVGSGAFMPTPEASQELAETIAEVASRAGTPTTALLTD
MSQPLAPCAGNALEVHEALAVLTGKRPNSRLLEVTRGLAVEMLLAGGLAPDRDAALKRLD
ERLASGEAAERFGRMVAGLGGPADLLDAPDRHLPVAPVVRPVLAPHAGHLRGLDTRALGM
TVVELGGGRRQPGEAIDHAVGLADIAELGSKLDAGQPLATLHARSHAEADQAERQLLDAI
EIGEARPSPTLIRDIIRREAP
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgctgccccaggaagccatccgcgccaagcgcgatggccaggcactggacgcggcagcc
atcggcgagctcgtcgccggcattgccgacggcagcctcggtgacgcccagatcggggcg
ctggccatggccattttcctcaacggcatgaacgccaccgagacggtggcgttgaccgag
gcggtgcgcgactccggcgacgtgctcgactggacggcgctcgacctgcccgggccggtc
atcgacaagcactccaccggcggcgtgggcgacgtcgtctcgctgatcctcggcccctgg
gtcgccgcctgcggcggccatgtgccgatgatctcgggccggggcctcggtcacaccggc
ggtaccctggacaagctggagtcgatccccggctattcggtcactcccgacactgccacc
ttccggcgactggtcgaggacgtcggcgtggccatcatcggccagaccgccgacctcgcc
cccgccgacaagcgcctctatgcgatacgcgacgtcaccgccacggtggagtcgctgccg
ctgatcgtctcttccattctcggcaagaagctcgcctgcgggctcgatgccctggtgatg
gacgtcaaggtcggcagcggcgccttcatgcccacgccagaggcctcgcaggaactggcc
gagaccatcgccgaggtcgccagtcgcgccggcacccccaccaccgcgctgctcaccgac
atgagccagcccctggcgccctgcgcgggcaatgccctggaagtgcatgaggcgctggcc
gtgctcaccggcaagcgcccgaacagccgcctgctcgaagtgacccgcggcctggcggtg
gaaatgctgctggccggcggcctggctcccgaccgggatgccgccctgaagcggctcgac
gaacggctcgcctcgggcgaggccgccgagcgtttcgggcgcatggtggccggtctcggc
ggccctgccgacctgctcgacgccccggatcgtcacctgcccgtcgccccggtggtgcgc
ccggtactcgcgccgcacgccggccacctgcgcggcctggacacccgggcactgggcatg
acggtggtcgaactcggtggcggccgccgccagccgggcgaagccatcgatcacgcggtg
ggcctggccgatatcgccgaactcggcagcaagctcgacgccggccaaccgctcgccacc
ctgcatgcgcgcagccacgccgaggccgaccaggccgagcgtcaactgctcgatgccatc
gagatcggcgaggcccgcccatctcccaccctgattcgcgacatcattcgccgggaggct
ccatga

DBGET integrated database retrieval system