KEGG   Halomonas elongata: HELO_3160Help
Entry
HELO_3160         CDS       T01311                                 

Gene name
deoA
Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
hel  Halomonas elongata
Pathway
hel00240  Pyrimidine metabolism
hel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    HELO_3160 (deoA)
Enzymes [BR:hel01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     HELO_3160 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: CBV43044
UniProt: E1V589
Position
2539576..2540901
Genome map
AA seq 441 aa AA seqDB search
MLPQEAIRAKRDGQALDAAAIGELVAGIADGSLGDAQIGALAMAIFLNGMNATETVALTE
AVRDSGDVLDWTALDLPGPVIDKHSTGGVGDVVSLILGPWVAACGGHVPMISGRGLGHTG
GTLDKLESIPGYSVTPDTATFRRLVEDVGVAIIGQTADLAPADKRLYAIRDVTATVESLP
LIVSSILGKKLACGLDALVMDVKVGSGAFMPTPEASQELAETIAEVASRAGTPTTALLTD
MSQPLAPCAGNALEVHEALAVLTGKRPNSRLLEVTRGLAVEMLLAGGLAPDRDAALKRLD
ERLASGEAAERFGRMVAGLGGPADLLDAPDRHLPVAPVVRPVLAPHAGHLRGLDTRALGM
TVVELGGGRRQPGEAIDHAVGLADIAELGSKLDAGQPLATLHARSHAEADQAERQLLDAI
EIGEARPSPTLIRDIIRREAP
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgctgccccaggaagccatccgcgccaagcgcgatggccaggcactggacgcggcagcc
atcggcgagctcgtcgccggcattgccgacggcagcctcggtgacgcccagatcggggcg
ctggccatggccattttcctcaacggcatgaacgccaccgagacggtggcgttgaccgag
gcggtgcgcgactccggcgacgtgctcgactggacggcgctcgacctgcccgggccggtc
atcgacaagcactccaccggcggcgtgggcgacgtcgtctcgctgatcctcggcccctgg
gtcgccgcctgcggcggccatgtgccgatgatctcgggccggggcctcggtcacaccggc
ggtaccctggacaagctggagtcgatccccggctattcggtcactcccgacactgccacc
ttccggcgactggtcgaggacgtcggcgtggccatcatcggccagaccgccgacctcgcc
cccgccgacaagcgcctctatgcgatacgcgacgtcaccgccacggtggagtcgctgccg
ctgatcgtctcttccattctcggcaagaagctcgcctgcgggctcgatgccctggtgatg
gacgtcaaggtcggcagcggcgccttcatgcccacgccagaggcctcgcaggaactggcc
gagaccatcgccgaggtcgccagtcgcgccggcacccccaccaccgcgctgctcaccgac
atgagccagcccctggcgccctgcgcgggcaatgccctggaagtgcatgaggcgctggcc
gtgctcaccggcaagcgcccgaacagccgcctgctcgaagtgacccgcggcctggcggtg
gaaatgctgctggccggcggcctggctcccgaccgggatgccgccctgaagcggctcgac
gaacggctcgcctcgggcgaggccgccgagcgtttcgggcgcatggtggccggtctcggc
ggccctgccgacctgctcgacgccccggatcgtcacctgcccgtcgccccggtggtgcgc
ccggtactcgcgccgcacgccggccacctgcgcggcctggacacccgggcactgggcatg
acggtggtcgaactcggtggcggccgccgccagccgggcgaagccatcgatcacgcggtg
ggcctggccgatatcgccgaactcggcagcaagctcgacgccggccaaccgctcgccacc
ctgcatgcgcgcagccacgccgaggccgaccaggccgagcgtcaactgctcgatgccatc
gagatcggcgaggcccgcccatctcccaccctgattcgcgacatcattcgccgggaggct
ccatga

DBGET integrated database retrieval system