KEGG   Halomonas elongata: HELO_3454Help
Entry
HELO_3454         CDS       T01311                                 

Gene name
fdhA
Definition
(GenBank) glutathione-independent formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
hel  Halomonas elongata
Pathway
hel00625  Chloroalkane and chloroalkene degradation
hel00680  Methane metabolism
hel01100  Metabolic pathways
hel01120  Microbial metabolism in diverse environments
hel01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    HELO_3454 (fdhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HELO_3454 (fdhA)
Enzymes [BR:hel01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     HELO_3454 (fdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C PALP ADH_N_assoc FAD_binding_3 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: CBV43338
UniProt: E1V6V9
Position
complement(2890727..2891920)
Genome map
AA seq 397 aa AA seqDB search
MSTANRGVVYKGPGQVAVESIPYPELALGNRKCQHGVILKVVTTNICGSDQHMVRGRTTA
PEGLVLGHEITGIVIETGRDVEFLKPGDMVSVPFNIACGRCRNCKEGQTGICLNVNPARP
GAAYGYVDMGGWVGGQTDYVMVPYADFNLLKFPDADQAMEKIRDLTLLSDIFPTGFHGCV
TAGVGPGSTVYVAGAGPVGLAAAVSAQLLGAACVIVGDMIEERLAQARSFGCETIDLTQD
GDMADKIEVILGEREVDAFVDCVGFEAHACGCNHGKEAPAAVLNSAMSLTRAGGQIGIPG
LYVTEDPGAADEAAKQGSLSMRFGQGWAKSHSFHTGQCPVMKYHRPLMQAILFDKVKIAD
AVNVQMITLDDAPKGYADFDGGAAKKFVMDPHGSVAA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagccaaccgcggtgtcgtctacaagggcccagggcaagtcgccgtcgagtcg
attccctacccggaacttgcgcttggcaatcgcaaatgccagcacggcgtgattctcaag
gtcgtgaccaccaacatctgtggcagtgaccagcacatggtacgaggccgcaccacggcc
cccgaggggttggttctcggccatgaaatcactggaatcgtcattgaaaccggacgtgat
gtcgagttcctcaagccgggcgatatggtctcggtacccttcaatatcgcctgcggtcgc
tgccgtaactgcaaggaaggccagaccggtatctgcctgaacgtcaatccggctcgtccc
ggtgccgcctacggttacgtcgacatgggcggttgggtcggtggccagaccgactacgtc
atggtgccctatgccgacttcaacctgctgaaattcccggatgccgatcaggcgatggag
aagatccgtgacctgaccctgctgtccgatatcttccccaccggcttccatggctgtgtc
accgctggcgttggtccgggcagcaccgtctatgtcgctggcgccggtccggtcggtctg
gccgcggcggtatccgcgcagttgctgggcgcggcctgcgtcatcgtcggcgacatgatc
gaggagcgcctggctcaggcccgcagcttcggttgcgagaccatcgacctgacccaggat
ggcgacatggccgacaagatcgaggtgatcctgggcgagcgcgaggttgatgccttcgtc
gactgtgtcggtttcgaggcccatgcctgtggctgcaatcacggcaaggaggcgcccgcg
gccgtgctgaactccgccatgtcgctgactcgtgccggcgggcagatcggtattccgggt
ctgtacgtgaccgaggatcccggcgccgctgacgaagcggccaagcaaggctctctgagc
atgcgcttcggtcagggctgggcgaaatcccattccttccataccggtcagtgcccggtc
atgaaatatcaccgtccgctgatgcaggcgatcctgttcgacaaggtcaagatcgctgac
gcggtcaatgtccagatgatcactctggatgatgcgcccaagggctatgccgacttcgac
ggtggcgcggcgaagaaattcgtcatggatcctcatggcagtgtcgctgcctga

DBGET integrated database retrieval system