KEGG   Halomonas elongata: HELO_3602Help
Entry
HELO_3602         CDS       T01311                                 

Gene name
tesA
Definition
acyl-CoA thioesterase I (EC:3.1.2.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
hel  Halomonas elongata
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    HELO_3602 (tesA)
Enzymes [BR:hel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     HELO_3602 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     HELO_3602 (tesA)
Lipid biosynthesis proteins [BR:hel01004]
 Fatty acid synthase
  Component type
   HELO_3602 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3061924..3062610
Genome map
AA seq 228 aa AA seqDB search
MRQRSPVDRVHNPHRRLLWRICLALMLCLMVGPVLAAPRPLILVMGDSLSAAYGIERQDG
WVSLLTDRLAGKARVVNASISGETTAGGKTRLPELLRQHDPDIVLLELGGNDGLRGLPPA
QMRSNLADMIEASQASGAEVALLGIDIPPNYGQAYREAFTGVFTALAERYEVPLLPFMLD
DVALHDELMQDDGIHPTAAAQPQILDNVWPVLAPLLENSGAELAERQG
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgcggcagcgttcccccgttgatcgagttcacaacccccatcggcggcttctatggcgc
atctgtctggccctgatgctatgcctgatggtgggcccggtactggctgcgccacgcccg
ctgatcctggtgatgggcgatagcttgagcgccgcctacggtatcgaacgccaggacggc
tgggtcagcttgctgaccgatcgcctggcaggcaaggcccgggtcgtcaacgccagcatc
agcggcgagaccaccgccggcggcaagacccggctgcccgagctgctgagacagcatgac
ccggacatcgttctgctcgaactgggcggcaacgacggcctgcgcgggctgccgcccgcc
cagatgcgcagcaatctggcggacatgatcgaggccagccaggcatccggcgccgaggtg
gcactgcttggtatcgacattccgcccaactatggccaggcctatcgcgaggccttcacc
ggggtcttcacggcgctcgcggagcgttacgaggttcccctgctgcccttcatgctcgac
gacgtggccctgcacgacgaactgatgcaggacgacggcatccaccccaccgccgccgcc
cagccacagatactcgacaacgtctggccggtgcttgccccgctgctggagaactcgggt
gccgaactcgccgagcgccagggctga

DBGET integrated database retrieval system