KEGG   Halomonas elongata: HELO_3629Help
Entry
HELO_3629         CDS       T01311                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hel  Halomonas elongata
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HELO_3629 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HELO_3629 (glk)
   00052 Galactose metabolism
    HELO_3629 (glk)
   00500 Starch and sucrose metabolism
    HELO_3629 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HELO_3629 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HELO_3629 (glk)
   00524 Butirosin and neomycin biosynthesis
    HELO_3629 (glk)
Enzymes [BR:hel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HELO_3629 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3087542..3088510
Genome map
AA seq 322 aa AA seqDB search
MTRPALIGDIGGTNARFALVTPGAFAPHDIHSLPCADYPGIVEAARDYLTRVGATGDQAP
REACLAFACPVHDERVVMTNNHWDFTKTAVREALGLDLFKVINDFMAQALGVPHVADDEL
VTLQQGTTAPHAARLVIGPGTGLGVAGVFPGRHDWIPLPTEGGHVTFAPTDEREQNLQRH
FRNRYGRISVERLLCGQGLLDLYIAHCSLKGANPRYQKPAEVTEAAGSGDPVARDTLLRF
LKILGDVSGDAALTMGARGGVYLCGGILPRLLDWLPESRFLEAFAHKGRMSAYTAEIPVH
VVTAPWTGLLGAAEALHNPEVE
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacccgacccgctctgatcggcgacatcggcggcaccaacgcccgcttcgcgttggtg
acgccgggcgccttcgcgccccacgacatccatagcctgccctgcgccgactatcccggc
atcgtcgaggcagctcgcgattacctgacccgcgtcggcgccaccggcgaccaggcccct
cgcgaggcctgcctggccttcgcctgcccggtgcatgacgaacgcgtggtgatgaccaac
aaccactgggacttcaccaagacggccgtgcgcgaagcgctgggcctcgatctgttcaag
gtcatcaacgacttcatggcccaggccctgggcgtgccccacgtcgccgacgacgaactg
gtcaccctccagcaaggcacgacagccccgcacgccgcacgcctggtgatcggtcccggt
accggcctcggcgtggccggggtcttccccgggcgccacgactggatcccgctgcccacc
gagggcgggcacgtgaccttcgcccccaccgacgagcgcgaacagaacctgcagcgccac
ttccgcaaccgctatggccgcatctcggtggagcgcctgctctgcggccagggcctgctg
gatctgtatatcgcccactgctcgctgaagggcgccaacccacgctaccagaagcccgcc
gaggtcacggaagcagccggcagcggcgacccggtggcacgtgataccctgctgcgtttc
ctgaagatcctcggcgacgtcagcggcgatgccgcgcttaccatgggcgcacgcggtggc
gtctatctgtgcggcgggatactaccgcgcctgctggactggctgccggagagccgcttc
ctggaggccttcgcccacaagggccggatgagcgcctacaccgcggagatcccggtgcac
gtggtcaccgccccctggacgggcctgctgggcgccgccgaggctctgcacaatccagag
gtcgaatga

DBGET integrated database retrieval system