KEGG   Halomonas elongata: HELO_3629Help
Entry
HELO_3629         CDS       T01311                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hel  Halomonas elongata
Pathway
hel00010  Glycolysis / Gluconeogenesis
hel00052  Galactose metabolism
hel00500  Starch and sucrose metabolism
hel00520  Amino sugar and nucleotide sugar metabolism
hel00521  Streptomycin biosynthesis
hel01100  Metabolic pathways
hel01110  Biosynthesis of secondary metabolites
hel01120  Microbial metabolism in diverse environments
hel01130  Biosynthesis of antibiotics
hel01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HELO_3629 (glk)
   00052 Galactose metabolism
    HELO_3629 (glk)
   00500 Starch and sucrose metabolism
    HELO_3629 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HELO_3629 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HELO_3629 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HELO_3629 (glk)
Enzymes [BR:hel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HELO_3629 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: CBV43513
UniProt: E1V7S5
Position
3087542..3088510
Genome map
AA seq 322 aa AA seqDB search
MTRPALIGDIGGTNARFALVTPGAFAPHDIHSLPCADYPGIVEAARDYLTRVGATGDQAP
REACLAFACPVHDERVVMTNNHWDFTKTAVREALGLDLFKVINDFMAQALGVPHVADDEL
VTLQQGTTAPHAARLVIGPGTGLGVAGVFPGRHDWIPLPTEGGHVTFAPTDEREQNLQRH
FRNRYGRISVERLLCGQGLLDLYIAHCSLKGANPRYQKPAEVTEAAGSGDPVARDTLLRF
LKILGDVSGDAALTMGARGGVYLCGGILPRLLDWLPESRFLEAFAHKGRMSAYTAEIPVH
VVTAPWTGLLGAAEALHNPEVE
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacccgacccgctctgatcggcgacatcggcggcaccaacgcccgcttcgcgttggtg
acgccgggcgccttcgcgccccacgacatccatagcctgccctgcgccgactatcccggc
atcgtcgaggcagctcgcgattacctgacccgcgtcggcgccaccggcgaccaggcccct
cgcgaggcctgcctggccttcgcctgcccggtgcatgacgaacgcgtggtgatgaccaac
aaccactgggacttcaccaagacggccgtgcgcgaagcgctgggcctcgatctgttcaag
gtcatcaacgacttcatggcccaggccctgggcgtgccccacgtcgccgacgacgaactg
gtcaccctccagcaaggcacgacagccccgcacgccgcacgcctggtgatcggtcccggt
accggcctcggcgtggccggggtcttccccgggcgccacgactggatcccgctgcccacc
gagggcgggcacgtgaccttcgcccccaccgacgagcgcgaacagaacctgcagcgccac
ttccgcaaccgctatggccgcatctcggtggagcgcctgctctgcggccagggcctgctg
gatctgtatatcgcccactgctcgctgaagggcgccaacccacgctaccagaagcccgcc
gaggtcacggaagcagccggcagcggcgacccggtggcacgtgataccctgctgcgtttc
ctgaagatcctcggcgacgtcagcggcgatgccgcgcttaccatgggcgcacgcggtggc
gtctatctgtgcggcgggatactaccgcgcctgctggactggctgccggagagccgcttc
ctggaggccttcgcccacaagggccggatgagcgcctacaccgcggagatcccggtgcac
gtggtcaccgccccctggacgggcctgctgggcgccgccgaggctctgcacaatccagag
gtcgaatga

DBGET integrated database retrieval system