KEGG   Halomonas elongata: HELO_3630Help
Entry
HELO_3630         CDS       T01311                                 

Definition
epimerase (EC:4.2.1.9)
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
hel  Halomonas elongata
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HELO_3630
Enzymes [BR:hel01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     HELO_3630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3088527..3089525
Genome map
AA seq 332 aa AA seqDB search
MIPETLRALLDATQGQRRAEWAGREVWLANEAWGELAVSLQGAQVLHYLPAPEAAQAEGS
LPAPEAAQAEGSVPAPEAAASEDAQPTETPEGMVAGGWLWVTPTPQELPGAIRGGIPLCW
PWFADERTADESPDRSGPMHGPARTADWRLDAVDEHEEGVELHLSPLERLHTQLVPRAVI
QANAQRLHVELITEHTGETPVKITGALHSYLAVADAFACRVEGLTGARYLDKLKDFAESE
QQGELGVRSGIDRIYHSNEESVLDDGHRRLRIARQGSDSVVVWNPGDAPPDDTSLAAARR
FLCVESANTRLDPVWLVPGAQHLLGTTLSRAI
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgattcccgaaacactgcgcgccctgctggatgccacccagggccaacgccgcgccgaa
tgggccgggcgcgaagtctggctggccaacgaagcctggggcgaactcgccgtgtcgctc
cagggcgcccaagttctgcactatctaccagcgcccgaagccgcgcaagctgaaggctct
ttaccagcgcccgaggccgcgcaagctgaaggctctgtaccagcacccgaagctgcggca
agcgaagacgcacaaccgaccgaaacgccggaaggcatggtggccggtggttggttgtgg
gtgacgcccacgccccaggaactgcccggcgcgatccgcggcggcatcccgctgtgctgg
ccctggtttgccgacgaacgtaccgccgacgaatcccccgaccgctcgggtcccatgcac
ggcccggcgcgcacggccgactggcgcctcgatgccgtggacgagcacgaggaaggcgtg
gagctgcatctcagcccgctcgagcgcctgcacacccagctcgtgccccgcgcggtgatc
caggccaacgcccagcgcctgcacgtcgaactgatcaccgagcataccggggagaccccg
gtgaagatcaccggcgccctgcacagctatctcgcggtggccgatgccttcgcctgccgc
gtcgaaggcctgacgggcgcccgctatctcgacaagctcaaggacttcgccgagagcgaa
cagcaaggcgaactcggcgtgcgcagcggcatcgatcgcatctatcacagcaacgaagaa
agcgtgctcgacgatggccaccgacgcctgcgcatcgcccgccagggcagcgactcggtg
gtggtgtggaatcccggcgatgcgccgcccgacgacacctcgctggccgccgcgcggcgt
ttcctgtgcgtcgaatcggccaacacccggctcgacccggtgtggctggtgcccggcgcc
cagcacctgctgggcacgacgctgtcgcgggcgatctga

DBGET integrated database retrieval system