KEGG   Halomonas elongata: HELO_3668Help
Entry
HELO_3668         CDS       T01311                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
hel  Halomonas elongata
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:hel00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3126769..3127338
Genome map
AA seq 189 aa AA seqDB search
MSQLTQDYDHRDALLVVDMQNDFCPGGALAVAGGDALVPGINAEMDAAQRAGALVVASRD
WHPVDHASFAHRGGPWPVHCVQDTPGAAFHADLALPETTIRVSKATAFDRDAYSAFDDTG
LGDYLRERGIERVTVCGLALDVCVKATTLDALREGFATRLLEDLSAAVDPDAIEECRDTL
ADAGAELCR
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagctcacccaggactacgaccaccgcgatgccctgctggtggtcgacatgcag
aacgacttctgcccgggcggcgccctggccgtggccggcggcgacgcactggttccaggc
atcaacgccgagatggacgcggcgcagcgagccggcgccctggtcgtcgcctcccgggac
tggcacccggtggaccatgccagcttcgctcatcggggcggcccctggccggtgcactgc
gtgcaggacacgccgggtgccgccttccacgccgacctggcgctgcccgagacgaccata
cgcgtcagcaaggccaccgccttcgaccgcgatgcctactccgccttcgacgacaccgga
ctcggcgactacctgcgcgaacgcgggatcgagcgcgtcacggtctgcggcctggcgctg
gatgtctgtgtcaaggccaccacgctcgatgcgctgcgcgagggattcgccacgcgcctg
ctcgaagacttgagcgcagcggtggatcccgacgccatcgaggaatgtcgcgataccctc
gccgacgccggtgccgaactatgccgatga

DBGET integrated database retrieval system