KEGG   Halomonas elongata: HELO_3782Help
Entry
HELO_3782         CDS       T01311                                 

Gene name
ydgB
Definition
(GenBank) short chain dehydrogenase
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
hel  Halomonas elongata
Pathway
hel00670  One carbon pool by folate
hel00790  Folate biosynthesis
hel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HELO_3782 (ydgB)
   00670 One carbon pool by folate
    HELO_3782 (ydgB)
Enzymes [BR:hel01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     HELO_3782 (ydgB)
    1.5.1.50  dihydromonapterin reductase
     HELO_3782 (ydgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NmrA TrkA_N NAD_binding_10 GDP_Man_Dehyd
Motif
Other DBs
NCBI-ProteinID: CBV43666
UniProt: E1V8L0
Position
complement(3269093..3269806)
Genome map
AA seq 237 aa AA seqDB search
MSAAPILITGGAQRLGRHCAERLCDDGHPVIITYRRERPALEALRARGVVTLQADFGDQA
GIRDFIVRLRETTSSLRAIVHNASDWLPDAEGDEAADNFEHLFRVHMLAPYLINLEARDL
LEACGEPLRDIVHMTDYVATRGSRKHIAYAASKAGLENLTLSFAARYAPSIQVNTIAPAM
IMLGENDDEAYAEKARAKSALGTIPGPGVIYESLRYLLDNRYVTGTTLPVDGGRHLR
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcggcgccgatcctgatcacggggggcgcgcagcggctcgggcggcattgcgcc
gaacgcttgtgcgacgacggacacccggtgatcatcacctaccgtcgcgaacggccggcg
ctggaggcattgcgcgcgcgtggcgtcgttaccctgcaggccgatttcggcgaccaggcg
ggcattcgcgatttcatcgtgcggctgcgggaaaccacctcgtcgctgcgggccatcgtc
cacaatgccagcgactggctgcccgacgccgagggcgacgaggctgccgacaatttcgag
cacctgttccgggtgcacatgctggcgccctacttgatcaacctcgaggcacgcgatctg
ctcgaggcctgcggcgagcctttgcgcgacatcgtgcacatgaccgattacgtggcgacc
cggggctcgcgcaagcacattgcctatgcggcctccaaggcgggcctggagaatctgacg
ttgtccttcgccgcccgttacgccccctcgatccaggtcaacaccatcgcgccggctatg
atcatgctcggcgagaatgacgacgaggcctacgccgagaaggccagggccaagtcggcg
ctgggcacgatacccggccccggggtgatctacgaaagcctgcgctacctgctcgacaac
cgctatgtgaccgggacgaccctgccggtggatggcggccggcacttgcgttga

DBGET integrated database retrieval system