KEGG   Halomonas elongata: HELO_3856Help
Entry
HELO_3856         CDS       T01311                                 

Gene name
thrC
Definition
(GenBank) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hel  Halomonas elongata
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HELO_3856 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HELO_3856 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HELO_3856 (thrC)
Enzymes [BR:hel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HELO_3856 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3352163..3353551)
Genome map
AA seq 462 aa AA seqDB search
MRYISTRGQAPALSFEEVVLTGMASDGGLYVPEAVPQLSYEELADMAGCSYAEIAFRVMK
PYVGGEIDDETFRRIVRDAYSTFSHDAVVPLNQLDANHFLLELFHGPTLAFKDVALQLLG
RLLDHFLAKRGERAVIMGATSGDTGSAAIEGCRHCDNLDIFILHPHERVSEVQRRQMTSV
LADNVFNIAIEGNFDDAQAMVKASFADQSFLNGTRLVAVNSINWARIMAQIVYYVASAVA
LGAPHRKVSFCVPSANFGNVFAGYMAYRMGLPVERFVIATNANDILHRTLADNDFSKRDL
VATLAPSMDIVVSSNFERLLFEAYQRDGKAVAELLERFQEQPSALAEAPLARLREVFASH
SIDDATILEVIREAHQRTQEILDPHTATGYRAAERERGDEAVPMVTLATAHPAKFAEAVV
KAGFPGVPLPPHMDDLLEREERYTVLPAELSAVQAFVAENRR
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatatcagtacccgcgggcaggcgcccgcgctttccttcgaggaggtcgtgctc
accggcatggccagcgacggcgggctctatgtacccgaggcggtgcctcagctcagctat
gaggaactggccgacatggccgggtgttcctacgccgagatcgcctttcgggtgatgaag
ccctatgtgggcggcgagatcgacgacgagaccttccgtcgcatcgtccgcgacgcctac
tccaccttcagccacgatgccgtggtgccgctcaaccagctcgatgccaaccatttcctg
ctcgagctgtttcacggcccgacgctggcgttcaaggacgtggccctgcaactgctcggc
cggctgctggatcacttcctcgccaagcgcggcgaacgggcggtgatcatgggggcgact
tccggcgataccggctcggcggccatcgagggatgtcggcattgcgacaacctggacatc
ttcatcctgcatccccatgagcgggtctcggaagtgcagcgacgccagatgacctcggtg
ctggccgacaacgtcttcaacatcgccatcgagggcaacttcgacgatgcccaggcgatg
gtcaaggcgagcttcgccgaccagtccttcctcaacgggacccgactggtggcggtgaac
tcgatcaactgggcgcgcatcatggcccagatcgtctactacgtggcctctgccgtggca
ctgggcgcgccgcatcgcaaggtcagtttctgcgtgccgtcggccaatttcggcaatgtc
ttcgccggctacatggcgtatcgcatggggctgccagtcgagcgcttcgtcattgccacc
aacgccaacgacatcctgcaccgcacgctggccgacaacgacttttccaagcgcgacctg
gtcgccaccctggcgccctcgatggacatcgtggtgtcgtccaacttcgagcgcctgctg
ttcgaggcctatcagcgtgatggcaaggccgtggccgagctgctcgagcgttttcaggag
cagccctcggcattggccgaagcgccgctggcacggttgcgcgaggtgttcgccagccac
agcatcgacgatgccaccatcctggaagtgattcgcgaggcgcaccagcgtacccaggag
atcctcgatccccacaccgccaccggctatcgcgccgccgagcgcgagcggggcgatgag
gccgtaccgatggtgacgctggccaccgctcatccggccaagttcgccgaggcggtggtc
aaggccggcttccccggcgtgcccttgccgccgcacatggatgatctgctggagcgagaa
gagcgctatacggttctgcctgcggagctttccgcggtgcaggcgttcgttgccgagaac
cgccgttag

DBGET integrated database retrieval system