KEGG   Halomonas elongata: HELO_3858Help
Entry
HELO_3858         CDS       T01311                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hel  Halomonas elongata
Brite
Enzymes [BR:hel01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HELO_3858 (dsbC)
Secretion system [BR:hel02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HELO_3858 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3355116..3355853)
Genome map
AA seq 245 aa AA seqDB search
MKVSTLSLAGGLLAAALTLPTMAWAAAPESLENIEVSGHSMPVKDVRETPMADIYEVRLE
TGETFYTNAEGNYFLVGDLFEKTDTGLVNLTEKARNAERRARVDEVPDDQRVTFRGAETP
KARVVVFTDTTCPYCQRLHEEVPRFNELGIAVDYLAFPRGGMNSPGARELEQVWCADNSS
EALSAAFRDESLESDATCDNPVEEQYHLGLELGVQGTPAIILPDGSLVPGYVPAERLAAM
LGLDD
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtatcgaccctttccctggccggtggcctgctggccgccgctctgacattgccc
accatggcctgggccgccgcgcccgagtccctcgagaacatcgaggtgtcggggcacagc
atgccggtcaaggacgtgcgggagacccccatggcggatatctacgaggtgcgcctggag
accggggaaaccttctacaccaacgccgagggcaattatttcctggtgggggatctcttc
gagaagaccgacaccgggctcgtcaatctgaccgagaaggcgcgcaatgccgaacgccgc
gcccgggtggacgaggtgcccgacgaccagcgtgtgaccttccgtggtgccgaaacgccc
aaggccagggtcgtggtgttcaccgacaccacctgcccctattgccagcgactccatgag
gaagtgccgcgcttcaatgagctgggaatcgccgtggactatctggcctttccccgaggt
gggatgaactcgcccggtgcccgggagctggagcaggtctggtgcgcggacaattcgagc
gaggccttgtcggccgcgttccgtgatgaatcgctggaaagtgacgcaacctgcgacaat
ccggtcgaggaacagtatcatctgggactggaactcggcgtgcagggtacgccggccatc
atcctgcccgacggcagcctggtccccggttacgtaccggcggagcgcctggccgccatg
ctggggctggacgactga

DBGET integrated database retrieval system