KEGG   Halomonas elongata: HELO_4141Help
Entry
HELO_4141         CDS       T01311                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hel  Halomonas elongata
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HELO_4141 (tpiA)
   01230 Biosynthesis of amino acids
    HELO_4141 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HELO_4141 (tpiA)
   00051 Fructose and mannose metabolism
    HELO_4141 (tpiA)
   00562 Inositol phosphate metabolism
    HELO_4141 (tpiA)
Enzymes [BR:hel01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HELO_4141 (tpiA)
Exosome [BR:hel04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HELO_4141 (tpiA)
  Exosomal proteins of bladder cancer cells
   HELO_4141 (tpiA)
  Exosomal proteins of melanoma cells
   HELO_4141 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3691153..3691902)
Genome map
AA seq 249 aa AA seqDB search
MPTPLIAGNWKMNGSLDLIESFGRALADAELPSRLEVALMVPFPYLEAASRALTGSRAAL
GAQTLSDQPSGAFTGEVSGEMLREVGTSLVLVGHSERRTQFGEDDSAVLARVRRALECEL
TPVLCLGETLEERDADRGEAVVIGQLEAVLDGLEAGQRSRLVIAYEPVWAIGTGRTATPE
QAQAIHAAIRRRLARYGDGLAEGTQLLYGGSMKADNAADLLAQPDIDGGLVGGASLKIDD
FLAICQSAG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcctacgccgctgatcgccggcaactggaagatgaatggttccctggacctgatcgag
tccttcggccgggcgctcgccgatgccgagctgccgtcgcgtctcgaggtcgcgttgatg
gtgccctttccctatctggaggccgcttcgcgtgccttgaccggttctcgggcggccctc
ggggcgcagacgctcagtgaccagccttccggcgccttcaccggcgaggtgagtggcgag
atgctgcgcgaggtcggcaccagtctggtgctggtcggtcattccgagcgccgtacccag
ttcggcgaagacgactcggcggtgttggcgcgcgtgcgtcgcgcgctggagtgcgagctc
acgccggtgctgtgtctgggcgagaccctcgaggagcgcgatgccgatcgcggcgaggcc
gtggtgatcggtcagctggaagcggttctggacggcctggaggccgggcagcgcagccgg
ctggtcatcgcctacgagccggtctgggccatcgggaccggtcgtactgcgactcccgaa
caggcgcaggcgattcacgccgcgatccgtcgtcgccttgctcgctacggcgatggtctc
gcggaagggacccagttgctgtacggcggcagcatgaaagccgataatgccgccgatctg
ttggcccagccggatatcgacggcggcctggtgggcggcgcatccctcaagatcgatgat
ttcctagccatttgtcagtcagcaggttga

DBGET integrated database retrieval system