KEGG   Halomonas elongata: HELO_4141Help
Entry
HELO_4141         CDS       T01311                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hel  Halomonas elongata
Pathway
hel00010  Glycolysis / Gluconeogenesis
hel00051  Fructose and mannose metabolism
hel00562  Inositol phosphate metabolism
hel01100  Metabolic pathways
hel01110  Biosynthesis of secondary metabolites
hel01120  Microbial metabolism in diverse environments
hel01130  Biosynthesis of antibiotics
hel01200  Carbon metabolism
hel01230  Biosynthesis of amino acids
Module
hel_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HELO_4141 (tpiA)
   00051 Fructose and mannose metabolism
    HELO_4141 (tpiA)
   00562 Inositol phosphate metabolism
    HELO_4141 (tpiA)
Enzymes [BR:hel01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HELO_4141 (tpiA)
Exosome [BR:hel04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HELO_4141 (tpiA)
  Exosomal proteins of bladder cancer cells
   HELO_4141 (tpiA)
  Exosomal proteins of melanoma cells
   HELO_4141 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CBV44025
UniProt: E1VAS6
Position
complement(3691153..3691902)
Genome map
AA seq 249 aa AA seqDB search
MPTPLIAGNWKMNGSLDLIESFGRALADAELPSRLEVALMVPFPYLEAASRALTGSRAAL
GAQTLSDQPSGAFTGEVSGEMLREVGTSLVLVGHSERRTQFGEDDSAVLARVRRALECEL
TPVLCLGETLEERDADRGEAVVIGQLEAVLDGLEAGQRSRLVIAYEPVWAIGTGRTATPE
QAQAIHAAIRRRLARYGDGLAEGTQLLYGGSMKADNAADLLAQPDIDGGLVGGASLKIDD
FLAICQSAG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcctacgccgctgatcgccggcaactggaagatgaatggttccctggacctgatcgag
tccttcggccgggcgctcgccgatgccgagctgccgtcgcgtctcgaggtcgcgttgatg
gtgccctttccctatctggaggccgcttcgcgtgccttgaccggttctcgggcggccctc
ggggcgcagacgctcagtgaccagccttccggcgccttcaccggcgaggtgagtggcgag
atgctgcgcgaggtcggcaccagtctggtgctggtcggtcattccgagcgccgtacccag
ttcggcgaagacgactcggcggtgttggcgcgcgtgcgtcgcgcgctggagtgcgagctc
acgccggtgctgtgtctgggcgagaccctcgaggagcgcgatgccgatcgcggcgaggcc
gtggtgatcggtcagctggaagcggttctggacggcctggaggccgggcagcgcagccgg
ctggtcatcgcctacgagccggtctgggccatcgggaccggtcgtactgcgactcccgaa
caggcgcaggcgattcacgccgcgatccgtcgtcgccttgctcgctacggcgatggtctc
gcggaagggacccagttgctgtacggcggcagcatgaaagccgataatgccgccgatctg
ttggcccagccggatatcgacggcggcctggtgggcggcgcatccctcaagatcgatgat
ttcctagccatttgtcagtcagcaggttga

DBGET integrated database retrieval system