KEGG   Halomonas elongata: HELO_4254Help
Entry
HELO_4254         CDS       T01311                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hel  Halomonas elongata
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hel00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3819874..3820665)
Genome map
AA seq 263 aa AA seqDB search
MVGAPVLICRPGARAAPLAEAIEAAGFAVECGEVMALEALPESQAMRSAWLDFDQFQRVV
VTSPFAAECLAEALDRYWPQLPVGTEYYGVGPSTAAALHEALGVRVHVPPRGEEHSSEAL
LSLGSLQRLDGQRTLLVAGEGGRTLLAETLAERGARLTHLAVYRRRLLEPSPVLQRRLRE
GDYHALVVSSGEILEHLARWCSRTALDQPLIVSSHRLATLAGTLGFRVPVVASGATPAAL
AAAVARARDPEETDVDHDDLEKG
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggtgggcgcgccggtcctgatctgtcgcccgggggcacgtgcggcaccgctggccgag
gccatcgaggctgcgggcttcgccgtcgagtgcggcgaggtgatggcgctggaggcgctg
cccgagagccaggcgatgcgttccgcctggctggatttcgatcagttccagcgagtggta
gtgaccagccccttcgctgccgaatgcctggccgaggcgctggaccgttactggccgcaa
ctccccgtgggcaccgagtattacggtgtgggcccgagtaccgccgccgccctgcacgaa
gccctgggagtgcgcgtgcatgtgccgccacgcggcgaagaacattccagcgaggcgttg
ctctcgctggggtcactgcagcgactggatgggcagcgtaccctgttggtcgccggtgag
ggcgggcgcacgctgctggccgagactctggccgagcgcggcgcacgattgacgcatctg
gcggtctatcggcggcgtctgctcgagccgtcgccggtgttgcagcggcggttgcgggaa
ggcgactatcatgcgttggtggtgagtagcggagaaatcctcgaacatctggcaagatgg
tgttcacgtaccgccttggaccaaccgttaatcgtatccagtcacaggttggctacactg
gccggcacactggggtttcgtgttcccgtcgtggcatcgggagccacgcctgccgcactc
gcggccgccgtggcacgggccagggacccggaggagaccgatgtcgatcatgacgatctc
gaaaagggctag

DBGET integrated database retrieval system