KEGG   Halomonas elongata: HELO_4288Help
Entry
HELO_4288         CDS       T01311                                 

Gene name
glcB
Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
hel  Halomonas elongata
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HELO_4288 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HELO_4288 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    HELO_4288 (glcB)
Enzymes [BR:hel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     HELO_4288 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3852990..3855164)
Genome map
AA seq 724 aa AA seqDB search
MTQRITRHRLQVAAELDRFINEQALPGTGVDPEAFWAGVDALFHDLTPQNRELLAERERL
QAELDTWHRDNAGPVRDMAAYRAFLEKIGYLVEAPANVEVTTTKVDREIAVQAGPQLVVP
VNNARYALNAANARWGSLYDALYGTDAIADTEGAERGESFNPKRAEKVIAYARGVLDRAA
PLATGSHGEAVKYALRDGHLVVTLEGGRETGLKEPGKLVGFQGEAEAPDAVLLANHDLHL
EIQIDAGHPIGKTDPAGVKDVVVEAALTSIMDCEDSVAAVDAEDKVEVYANWLGLMKGDL
ETQIDKGGKTFTRRLNDDRTWRNPAGGEVTLPGRSLLFVRNVGHLMTTPAVLDAEGNELP
EGILDAVVTSLIALHDLAKGEGEPRNSREGSVYIVKPKMHGPKEVAFADTLFERVEDLLG
MTRDTLKMGIMDEERRTSVNLKACIAEATSRVVFINTGFLDRTGDEMHSTMEAGPMIRKG
DMKNSAWIGAYERSNVQTGLACGLRGHAQIGKGMWAMPDLMAAMLEQKIGHPKAGANTAW
VPSPTAATLHALHYHQVSVAEVQRELETQGEPDCLDELLTVPVAERPDWSDDEIQQELDN
NCQGILGYVVRWVEHGVGCSKVPDIHDVGLMEDRATLRISSQHVANWLHHGVVDEARVRD
TLERMAKVVDEQNAGDPDYTAMSADFSASHAFQAASDLIFKGLEQPAGYTEPLLHHWRAV
HKGA
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgacccaacgcatcacccgccatcgccttcaagtggccgccgagctggaccgcttcatc
aacgaacaggctctgccgggaaccggtgtcgatcccgaagccttctgggccggcgtggac
gccctctttcacgatttgacaccccaaaaccgcgaattgctcgccgagcgggagcgcctg
caggccgagctcgatacctggcaccgcgacaacgcagggccggtacgtgacatggcggcc
tatcgcgcctttctcgagaagatcggttatctggtcgaggcgccggcgaatgtcgaggtc
accaccaccaaggtggatcgcgagatcgccgtgcaggccggaccgcagctggtggtgccg
gtcaacaatgcccgctatgccctgaatgccgccaatgcgcgttggggcagcctgtacgac
gccctgtatggcaccgacgccatcgccgatacggaaggcgccgagcgtggcgagagcttc
aaccccaagcgtgccgagaaggtgatcgcctatgcccggggcgtgctggatcgcgccgct
cccctggccaccggttcccatggcgaggcggtcaagtatgccctgcgcgacgggcatctc
gtcgtcactcttgagggcggccgcgagaccggcctcaaggaacccggcaagctggtgggc
ttccagggggaagccgaagcgcccgatgcggtgctgctggccaatcacgacctgcatctg
gagatccagatcgatgccggccatcccatcggcaagaccgatcccgccggagtcaaggac
gtggtcgtggaggcggcgctgacctccatcatggactgcgaggactccgtggccgcggtg
gatgccgaagacaaggtcgaggtctacgccaattggctgggcctgatgaagggtgacctg
gaaacccagatcgacaagggtggcaagaccttcacgcgtcgtctcaacgatgatcgtacc
tggcgtaatcccgcgggtggcgaagtgaccctgccgggacgctcattgctgttcgtgcgc
aatgtcggccatctcatgaccacgccggcggtactcgatgccgagggcaatgaactgcct
gagggcatcctcgatgccgtcgtcaccagcctgatcgccctgcacgacctggccaagggc
gagggtgagccgcgcaactcccgcgagggctcggtgtacatcgtcaagcccaagatgcat
ggcccgaaggaagtcgccttcgccgatacgctcttcgagcgcgtcgaagacctgctgggc
atgacccgcgacaccctgaagatgggcatcatggacgaggaacgccgcacctcggtgaac
ctcaaggcatgtatcgccgaggccacttcgcgcgtggtgttcatcaacaccggcttcctc
gatcgcaccggcgacgagatgcactcgaccatggaagccggcccgatgatccgcaaggga
gacatgaagaatagcgcctggatcggtgcctacgagcgcagcaacgtccagaccggcctg
gcctgcgggctgcggggccacgcccagatcggcaagggtatgtgggccatgccggatctg
atggcggcgatgctcgagcagaagatcggccaccccaaggccggcgccaacactgcctgg
gtgccatctcccacggcggccaccctgcatgcgctgcattatcaccaggtcagcgtggcc
gaggtgcagcgcgagctcgagacccagggagaacccgattgcctggacgagctgctgacc
gtgccggtggccgagcgcccggactggagcgacgacgagattcagcaggagctcgacaac
aactgccaggggatcctcggctatgtggtgcgctgggtcgagcacggcgtggggtgctcc
aaggtgccggatatccatgatgtcggcctgatggaggatcgcgcgaccctgcgtatctcc
agccagcacgtggccaactggttgcaccacggcgtggtggacgaggcccgggtgcgggat
accctggagcgcatggcgaaggtcgtcgacgagcagaacgccggagatccggactatacg
gcgatgagcgccgacttctcggcctcccatgccttccaggccgcctccgatctgatcttc
aagggactcgagcagcccgccggttacaccgagccgctgctgcaccactggcgcgccgtt
cacaagggcgcctga

DBGET integrated database retrieval system