KEGG   Halomonas elongata: HELO_4326Help
Entry
HELO_4326         CDS       T01311                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hel  Halomonas elongata
Pathway
hel00260  Glycine, serine and threonine metabolism
hel00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hel01100  Metabolic pathways
hel01110  Biosynthesis of secondary metabolites
hel01130  Biosynthesis of antibiotics
hel01230  Biosynthesis of amino acids
Module
hel_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HELO_4326 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HELO_4326 (trpB)
Enzymes [BR:hel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HELO_4326 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CBV44210
UniProt: E1VBQ3
Position
3894668..3895900
Genome map
AA seq 410 aa AA seqDB search
MGFSTPRHDPVPDANGCFGHFGGRFVAETLMPLTLELQAQYAAVKDSASFRAELAALQRD
FVGRQSPLYFAERLTERLQGATIYFKREDLMHTGAHKINNCLGQLLLARHMGKRRIIAET
GAGMHGVATATVAARFGMDCTVYMGSADIDRQRPNVERMQLLGAEIVPVSHGTGTLKDAM
NEAMRDWTTNVASTFYVIGTVAGPHPYPSLVRDFQSVIGQEVREQMLEREGRLPDSLLAC
IGGGSNAMGLFHPFVQEPDVRLIGVEAAGQGLETGRHAASLQGGTPGVLHGNRTYLLQSA
EGQILDAHSISAGLDYPGIGPEHAWLHETGRGEYVAVTDDEAVDAFHTLCRLEGIIPALE
SSHAIAHAIKLAPTLPRSHRMVINLSGRGDKDMASVADYMTAKPNDRGTQ
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgggcttttccacaccgaggcacgaccccgtccccgatgccaatggctgcttcggccat
ttcgggggccgcttcgtcgccgagaccctgatgccactgacgctcgagcttcaggcgcaa
tatgcggcggtgaaggacagcgcctcatttcgtgccgaactggcagccttgcagcgggac
ttcgtcggccgtcaaagccccctgtatttcgccgagcgcctgaccgaacgactgcagggc
gcgacgatctacttcaagcgcgaagacctgatgcacaccggcgcgcacaagatcaacaat
tgcctgggccagttgctgctcgcccggcacatgggcaagcggcggatcatcgccgaaacc
ggtgccggcatgcacggcgtggcgacagccaccgtggcggcccgcttcggaatggactgc
accgtctacatgggcagcgccgatatcgaccgccagcgtcccaatgtagagcgcatgcaa
ttgctcggtgccgagatcgtgccggtgagtcacggtacgggcaccttgaaggatgcaatg
aacgaggcgatgcgcgactggaccaccaatgtggcctccaccttctatgtcatcggcacc
gtggccggtccccatccgtatccgagcctggtccgggatttccagtccgtcatcggccag
gaggttcgcgagcagatgctcgaacgggagggacggctgcccgactccctgctggcctgc
atcggtggcggctcgaatgccatgggcctcttccaccccttcgtgcaggagcccgacgta
cgcctgatcggcgtggaagcggccggccagggcctcgagaccggccggcatgccgccagc
ctgcagggcggcacgcccggcgtcctgcacggcaatcgcacctacttgttgcagtccgca
gaggggcagatcctcgatgcccattccatctcggccgggctcgattatccgggcatcggt
ccggaacatgcctggctgcacgagacgggacgcggcgagtatgtcgctgtcaccgatgac
gaagcggtcgacgccttccataccctctgccggctggaagggatcattcccgccctggag
tcctcccatgccattgctcacgccatcaagctggcgccgactttgccgcgctcgcaccgc
atggtgatcaacctgagcggacgcggcgacaaggacatggcgagcgtcgccgactacatg
accgccaagcccaacgaccgaggaacgcaatga

DBGET integrated database retrieval system