KEGG   Helicobacter pylori UM298: K748_01725Help
Entry
K748_01725        CDS       T02757                                 

Definition
catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
hem  Helicobacter pylori UM298
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hem00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    K748_01725
  Amino acid metabolism
   00380 Tryptophan metabolism
    K748_01725
Enzymes [BR:hem01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     K748_01725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
351395..352339
Genome map
AA seq 314 aa AA seqDB search
MKKIGLSLCLVFSLGFLKAHEVSAEEIADIFYKLNAKEPKMKINHTKGFCAKGVFLPNVQ
AKKDLDVPLLNEKEIPASVRYSLGGVAMDDKSKVRGMALKLENQNASWTMVMLNTEINFA
KNPNEFAQFFEMRIPKNGKVDEARIKKLYEEIPSYRNFAAYTKTIGISSSVANTPYYSVH
AFKFKDKKEKLLPARWKFVPKDGIKYLNPQELKQKDSNYLLSSFQQHLKDKPIEYQMYLV
FANKNDATNDTTALWKGKHKELLVGTLKVEKYEGMGCNKDVYFPADLPKGVEAPTDPLFQ
IRNEVYGITFNRRQ
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattggtttgagcttgtgtttggtttttagcttgggttttttaaaagcccat
gaagtgagcgctgaagagattgcggatattttctacaaactcaacgccaaagagcctaaa
atgaaaatcaaccacactaaggggttttgcgctaaaggcgtgttcctccctaatgtgcaa
gcaaaaaaggatttagatgtgccattactcaatgaaaaagaaatccctgcgtctgtaagg
tattctttaggaggcgtggcgatggacgataaaagcaaagtcaggggaatggcgttaaaa
ttagaaaaccaaaacgctagctggacaatggtgatgctcaatacagaaatcaattttgcc
aaaaaccctaacgaattcgctcaattttttgagatgagaatccctaaaaatggcaaggtg
gatgaagcaagaatcaaaaagctttatgaagaaatcccctcttataggaattttgccgct
tacacaaaaacgatagggattagctcaagcgtggctaacacgccttattatagcgtgcat
gcgttcaagtttaaagataagaaagaaaaattattgcctgcgagatggaaatttgtgcct
aaagacggcattaagtatcttaacccccaagaattaaagcaaaaagattcaaattatctg
ctttcttcattccaacaacaccttaaagataaacccatagaataccaaatgtatctggtg
tttgcgaataaaaatgatgccaccaacgacacgaccgcgctttggaaaggcaaacacaag
gaattactggtagggacattgaaagttgaaaaatacgaaggaatgggttgcaataaagat
gtgtatttcccagccgatctccctaaaggcgtagaagcccctactgatcccttattccaa
atcaggaatgaagtttatgggatcacttttaatagaaggcaataa

DBGET integrated database retrieval system