KEGG   Helicobacter pylori UM298: K748_02930Help
Entry
K748_02930        CDS       T02757                                 

Definition
disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hem  Helicobacter pylori UM298
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(585015..585812)
Genome map
AA seq 265 aa AA seqDB search
MILRASVLSALLLVGLGAAPKHSVSANDKRMQDNLVSVIEKQTNKKVRILEIKPLKSSQD
LKMVVIEDPDTKYNIPLVVSKDGNLVIGLSNIFFSNKSDDVQLVAETNQKVQALNATQQN
SAKLNAIFNEIPADYAIELPSTNAKNKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRM
VVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
VENTTKKIFESGMIKGVPFLYHYKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagagcgagtgtgttgagcgcgttacttcttgtaggcttaggggcagcccct
aaacattcagtttcagcgaatgacaaacggatgcaggataatttagtgagcgtgattgaa
aaacaaaccaataaaaaggtgcgtattttagaaatcaagcctttaaaatccagccaggat
ttaaaaatggtcgttattgaagatccggacactaaatacaatattccgcttgtagtgagt
aaggatggtaatttagtcatagggcttagcaatatcttttttagcaataaaagcgatgat
gtgcaattagtcgcagaaaccaatcaaaaagtccaagcccttaacgccacccaacaaaac
agcgcgaaattgaacgctatttttaatgaaataccggctgattatgcgatagagttgccc
tctactaacgctaaaaataaggataaaatcctttatattgtttctgatcccatgtgcccg
cattgccaaaaagagctcactaaactcagggatcacttgaaagaaaacaccgtgagaatg
gttgtagtggggtggcttggggtcaattcggctaaaaaagcggctttgatccaagaagaa
atggcgaaagctagggctaggggagcgagtgtggaagataaaatctctattcttgaaaag
atttattccacccaatacgatattaacgctcaaaaagagcctgaagatttacgcactaaa
gtggaaaataccactaaaaagatttttgaatctggcatgattaagggtgtgcctttctta
taccattataaggcatga

DBGET integrated database retrieval system