KEGG   Helicobacter pylori SNT49: HPSNT_00665Help
Entry
HPSNT_00665       CDS       T01916                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hen  Helicobacter pylori SNT49
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hen00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPSNT_00665
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPSNT_00665
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HPSNT_00665
Enzymes [BR:hen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HPSNT_00665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(133362..134822)
Genome map
AA seq 486 aa AA seqDB search
MPFVPTRSLKEKKIDFIEAILNPNAPKGGLYTLERFETLEWQDCLNLSYNELVECVFERL
GLEIPKGLLTSALKRYENFDNPKNPAPIFALNERLFVQELYHGPSLAFKDMALQPLASLF
SNLAVGKNEKYLMLVSTSGDTGPATLESLAGMPNVFVVCLYPKDGTSLVQKLQMVTQSAS
NLKVFGISGDFDDAQNALKNLLKDDDFNEALKACQLKLSVANSVNFGRIAFQIVYHIWGF
LELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKMGLNIAKIKVVTNSNDVLREFIETG
RYDLTHRSLKQTFSPAMDILKSSNVERVLFSLYGFERTLELMQALEEEKFYALKPKELAL
LQEHFSCASCSDEACLKTIQEVYAEHQYLIDPHTATALNASLKTNEKTLVSATASYEKFP
RTTLLALNEQKKNDNDKIALETLKNSYNTPDSQHLDDLFERGIKHQEVLKLSEIKSSILL
WLESLH
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgtccccacgcgttctttgaaagaaaaaaagattgattttattgaagcaata
ttaaaccccaacgcccccaaaggcgggctttacactttagagcgttttgaaacattagaa
tggcaagattgtttgaatctgagctataacgagctggtagaatgcgtgtttgagcggttg
ggtttagagattcctaagggtttattaacaagcgctttaaaacgctatgaaaattttgat
aaccctaaaaacccggcccctatttttgcactcaatgaaaggctttttgtccaagagctc
taccatgggcctagtttggcgtttaaagacatggcgttgcagcctttagcgagcttgttt
tctaatctagcggtagggaaaaatgaaaagtatttaatgctcgtttctacaagcggcgat
accggtcctgcgactttagaaagtttggcgggcatgcctaatgtttttgtggtgtgttta
taccccaaagacggcacgagtttagtccaaaaactccaaatggttacccaaagcgctagc
aatttaaaggtctttgggatcagtggggattttgatgatgcacaaaacgcactcaaaaac
cttttaaaagacgatgattttaacgaggctttaaaagcgtgccaattgaaattaagcgtg
gctaattccgtgaattttgggcgcatcgcttttcaaatcgtctatcatatttggggcttt
ttggaattgtataaaaaaggcgcgatcaattctaaagaaaaaatcaccctagccatacct
agcggtaattttgggaacgctttaggggcgttttatgccaaaaaaatgggcttgaatatc
gctaaaatcaaggtcgtaaccaacagcaatgatgttttaagggagtttatagaaacaggg
cgttacgatttaacccaccgctctttaaagcaaactttctcgccggctatggatatttta
aaaagctctaatgtggaaagggtgctttttagcctttatgggtttgaacgcacgctagaa
ttgatgcaagctttagaagaagagaaattttacgccttaaagcctaaagaattagccctt
ttacaggagcatttttcttgcgcgagctgctcagatgaagcttgtttgaaaacaatccaa
gaagtttatgcagagcaccaatacctgattgacccccacaccgccaccgctttaaacgct
agcttgaaaaccaacgaaaaaacccttgtttctgccaccgcctcttatgaaaaattccct
agaaccacccttttagccctaaacgagcaaaagaaaaacgataacgacaaaatcgcccta
gaaacgcttaaaaacagctacaataccccggatagccagcaccttgatgatttatttgaa
agaggaatcaaacaccaagaagttttaaaactcagtgagatcaaatcttctattcttttg
tggctagaaagcctacattaa

DBGET integrated database retrieval system