KEGG   Helicobacter pylori SNT49: HPSNT_00735Help
Entry
HPSNT_00735       CDS       T01916                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hen  Helicobacter pylori SNT49
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hen00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HPSNT_00735
Enzymes [BR:hen01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HPSNT_00735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
150561..151199
Genome map
AA seq 212 aa AA seqDB search
MPNMNTHTRGIDSNLIHSLKSISLSMFRKGFFGLYQGSISARIGANQFVINKRNAVFDQL
NENTLLVLHDKIDYRWKEASQDSPIHASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPR
DYLGYRSLGEEISIFNPKDYDSWQERADTEILRQLQESKKYFVFIKGCGIFAYHRELSKL
MEVFDLIENSCKVLRLGDLMDYCYNDDPRLSV
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgcctaacatgaacacacacacaagaggcattgacagcaatctgattcattcgctcaaa
agcatttcattatccatgtttagaaagggtttttttgggctttatcaaggctctatttca
gcgcgcattggtgcaaatcaatttgtgatcaacaaaagaaacgctgtttttgatcaattg
aatgaaaacaccttactggttttgcatgacaagatagattaccgctggaaagaagcgagc
caggattcgcccattcatgcgagcgtgtatagggagtttttggacgctaaattcatcgct
tacgcgcgccctccttatagtttggcgtattccttacgccacaaccgattgctccctagg
gattatttagggtatcgttctttgggtgaagaaatttccatttttaaccccaaagactat
gacagctggcaagaaagagcggatacagaaattttacgccaactgcaagagagcaaaaaa
tattttgttttcattaaggggtgtgggatttttgcctaccacagagagctttctaaactc
atggaagtttttgatttgattgaaaactcatgcaaggttttacgactaggcgatttaatg
gattattgctataatgatgatccacgattgagcgtgtaa

DBGET integrated database retrieval system