KEGG   Helicobacter pylori SNT49: HPSNT_01245Help
Entry
HPSNT_01245       CDS       T01916                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hen  Helicobacter pylori SNT49
Pathway
hen00300  Lysine biosynthesis
hen01100  Metabolic pathways
hen01120  Microbial metabolism in diverse environments
hen01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hen00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    HPSNT_01245
Enzymes [BR:hen01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HPSNT_01245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AEN16422
UniProt: G2MD65
Position
complement(247192..248358)
Genome map
AA seq 388 aa AA seqDB search
MNALEITQKLISYPTITPKECGIFEYIKSLFPAFKTLECGENGVKNLFLYRIFNPPKEHA
EKKHAEKEHAKEKVKPLHFCFAGHIDVVPPGDNWQNDPFKPIIKEGFLYGRGAQDMKGGV
GAFLSASLNFNPKTPFLLSILLTSDEEGPGIFGTKLMLEKLKEKDLLPHMAIVAEPTCEK
VLGDSIKIGRRGSINGKLILKGVQGHVAYPQKCQNPIDALASVLPLISGVHLDDGDEYFD
PSKLVITNLHAGLGANNVTPASVEIIFNARHSLKTTKESLKEYLEKVLKSVPHTLELESS
SSPFITASHSKLTSVLKENILKACHATPLLNTKGGTSDVRFFSAHGIEVVEFGVINDRIH
AVDERVSLKELELLEKVFLGVLEGLSEA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctttagaaatcacccaaaagctcatcagctaccccaccattacgcccaaagaa
tgcggtatttttgaatacattaaatcgctttttcctgcttttaaaaccctagaatgtggg
gaaaatggcgtgaaaaacctttttttataccgcatttttaacccccccaaagagcatgca
gaaaaaaagcatgcagaaaaagaacatgcaaaagaaaaggttaagcccttgcatttttgc
ttcgcagggcatattgatgtcgtgcctcctggagataattggcaaaacgatccctttaaa
cccatcattaaagaggggtttttatacggtcgtggggcgcaagacatgaaagggggcgtg
ggggcgtttttgagcgcgagtttaaattttaaccctaaaaccccttttttgctttctatt
ttactcacaagcgatgaagaagggccagggatttttggcacaaaactcatgctagaaaaa
ctcaaagaaaaagatttattgccccatatggcgattgtggctgaacccacttgcgaaaaa
gtcttaggcgatagcatcaaaattggccgaagaggctctattaatggcaaactcatttta
aaaggcgttcaagggcatgtagcttacccgcaaaaatgccaaaaccccattgacgcgctc
gcttctgttttgcccttgatttcaggagtccatttagacgacggcgatgaatattttgac
ccttcaaaattggttatcaccaacttgcacgcaggattaggggcgaataacgttacccca
gcaagcgtagaaatcatctttaatgcgcgccattctttaaaaaccaccaaagaaagtttg
aaagaatatttagaaaaagttttaaaaagcgtgcctcacactttagaattagaatcaagc
agttcgcctttcatcacggcgtctcattcaaagcttaccagcgttttaaaagaaaatatt
ttaaaggcatgccacgccaccccccttttaaacaccaaaggcggcacgagcgatgtgcgg
ttttttagcgctcatggtatagaagtggtggaatttggcgtgattaatgacaggatccat
gccgttgatgaaagggtgagcttgaaagaattagagcttttagaaaaagtgtttttaggg
gttttagagggcttgagtgaggcataa

DBGET integrated database retrieval system