KEGG   Helicobacter pylori SNT49: HPSNT_01265Help
Entry
HPSNT_01265       CDS       T01916                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hen  Helicobacter pylori SNT49
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:hen00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
252802..253908
Genome map
AA seq 368 aa AA seqDB search
MVVLGSTGSIGKNALKIAKKFKVEIEALSCGKNIALINEQIKVFKPKKVAILDPNDLNNL
EPLGAEVFVGLEGIDAMIEECVSHLVINAIVGVAGLKASFKSLQTNKKLALANKESLVSA
GHLLDISQITPIDSEHFGLWALLQNKTLKPKSLIISASGGAFRDTPLESIPIQNAQNALK
HPNWSMGSKITIDSASMVNKLFEILETYWLFGASLKIDALIERSSIVHALVEFEDNSIIA
HLASADMQLPISYAINPKLASLNASIKPLDLYALSAIKFEPISMERYTLWRYKDLLLENP
KLGVVLNASNEVAMEKFLNQEIAFGGLIKTISQALESYAKMSFKLSSLDEVLALDKEVRE
RFKNVAGV
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggttgttttaggaagcaccggctctattgggaaaaacgccctaaaaatcgccaaaaaa
ttcaaggtagaaatagaagccttgagctgtgggaaaaatatcgctttaatcaatgagcaa
atcaaagttttcaaacccaagaaagtggcgattttagatcctaacgatttgaataattta
gagcctttgggcgcggaagtgtttgtagggttagagggcattgatgcgatgatagaagag
tgcgtttcgcatttagtcattaacgccattgtgggcgtggcgggattaaaggcgagcttt
aaaagcttacaaactaacaaaaaactagccctagcgaataaagagagcttagtgagcgcg
gggcatttattagacatttcacaaatcacgcccattgacagcgagcattttggtttgtgg
gcgttgttgcaaaacaagactttaaagcctaaatccttaatcattagcgcgagtggaggg
gctttcagggacacgcctttagaatccattcccattcaaaacgcgcaaaacgcgctcaaa
caccctaactggagcatgggatctaaaatcaccattgattcagcgagcatggtcaataag
ctttttgaaatcctagaaacctattggctttttggcgcgtctttaaagattgatgcgctc
attgaaagaagctctatcgtgcatgctttggtggagtttgaagacaactctattattgcg
catttagcgagcgcagacatgcaattacccataagctatgccattaaccctaaattagct
tctttgaacgcttccatcaagcccttagatttatacgctttgagtgcgattaaatttgaa
cccattagcatggagcgctacactttgtggcgttataaagacttgttgctagaaaaccca
aagcttggcgtggtgctgaatgcgagcaatgaggtggcgatggagaagtttttaaatcaa
gaaatcgcttttggtgggcttatcaaaaccatttctcaagccttagaatcatacgctaaa
atgtccttcaagctctctagtttagatgaagtgctggcgttagataaggaagttagggag
cgttttaaaaatgtagcgggagtgtag

DBGET integrated database retrieval system