KEGG   Helicobacter pylori SNT49: HPSNT_01345Help
Entry
HPSNT_01345       CDS       T01916                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hen  Helicobacter pylori SNT49
Brite
Enzymes [BR:hen01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HPSNT_01345
Secretion system [BR:hen02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HPSNT_01345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
269260..270057
Genome map
AA seq 265 aa AA seqDB search
MILRASVLSALLLVGLGAAPKHSVSANDKRMQDNLVSVIEKQTNKKVRILEVKPLKSSQD
LKMVVIEDPDTKYNIPLVVSKDGNLIIGLSNIFFSNKSEDVQLVAETNQKIQALNATQQN
SAKLNAIFNEIPADYAIELPSTNAKNKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRM
VVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
VENTTKKIFESGVIKGVPFLYHYKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagagcgagtgtgttgagtgcgttacttcttgtaggcttaggggcagcccct
aaacattcagtttcagctaatgacaaacggatgcaggataatttagtgagcgtgattgaa
aaacaaaccaataaaaaggtgcgtattttagaagtcaaacctttaaaatccagccaggat
ttaaaaatggtcgtaatagaagatccggacactaaatacaatatcccgcttgtggtgagt
aaggatggtaatttaatcatagggcttagcaatatcttttttagcaataaaagcgaagat
gtgcaattagtcgcagaaaccaatcaaaaaatccaagcccttaacgccacccaacaaaac
agtgcgaaattgaacgctatttttaatgaaataccggctgattatgcgatagagttgccc
tctactaacgctaaaaataaggataaaatcctttatattgtttctgatcccatgtgcccg
cattgccaaaaagagctcactaaactcagggatcacttaaaagaaaacaccgtgagaatg
gttgtagtggggtggcttggagtcaattcggctaaaaaagcggctttgatccaagaagaa
atggcgaaagctagggctaggggagcgagcgtggaagataaaatctctattcttgaaaag
atttattccacccaatacgatattaacgctcaaaaagagcctgaagatttacgcactaaa
gtggaaaataccactaaaaagatttttgaatctggcgtgattaagggtgtgcctttttta
taccattataaggcatga

DBGET integrated database retrieval system