KEGG   Helicobacter pylori SNT49: HPSNT_01565Help
Entry
HPSNT_01565       CDS       T01916                                 

Definition
hypothetical protein
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hen  Helicobacter pylori SNT49
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hen00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPSNT_01565
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPSNT_01565
Enzymes [BR:hen01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPSNT_01565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
311757..312314
Genome map
AA seq 185 aa AA seqDB search
MQEIRILENLQKSLALKEGMLSYEMLGKSLSYNPYLPRVIPQTKDCVFVTPDEVLEKLLK
ENTHTECVIVNFKGLYEIGTPSVFDLEVLGLLRRHASSLIVHQDLFISHYQLLESLVQGS
DGVILDEELLKEDLKGMVEFSWRLGLGVFVETCKPDYTHLKDLGVLGVLEEIPHSYNQKK
IVFLD
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaataaggattttagaaaatttacaaaaaagcttggccttaaaagagggcatg
ctttcttatgaaatgctgggtaaaagcctgtcgtataacccttacttgcccagagtcatt
cctcaaaccaaagattgcgtttttgtaacccctgatgaggttttagaaaagcttttgaaa
gaaaacacccacacagaatgcgttattgtcaatttcaaaggattatacgaaataggcacg
ccaagcgtgtttgatttagaagttttagggttattgcgccgccatgcgagttctttgatt
gtccatcaagatcttttcatcagccattaccagcttttagaatcgcttgttcaaggctct
gatggggtcattttagatgaagagcttttgaaagaagatttaaagggcatggtagaattt
tcttggcgtttgggcttaggcgtgtttgtagaaacctgcaagccagactacacccattta
aaagatttaggggttttaggcgtgctagaagaaatcccccattcttataatcaaaaaaaa
atagtctttttagattga

DBGET integrated database retrieval system